CLUSTAL format seed alignment for MF_04141

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MODA_BPT4             MKYSVMQLKDFKIKSMDASVRASIREELLSEGFNLSEIELLIHCITNKPDDHSWLNEIIK
F2VX42_9CAUD          MKYSAMQLKDFKIKSMDASVRASIREELLSEGFNLSEIELLIHCITNKPDDHSWLNEIIK
A0A097J8J4_BPR51      MKYSVMQLKDFKIKSMDASVRASIREELLSEGFNLSEIELLIHCITNKPDDHSWLNEIIK
A0A097J5E0_BPR27      MKYSVMQLKDFKIKSMDASVRASIREELLSEGFNLSEIELLIHCITNKPDDHSWLNEIIK
A0A2K9VMH9_9CAUD      MKYSAMQLKDFKIKSMDASVRASIREELLSEGFNLSEIELLIHCITNKPDDHTWLNEIIK
A0A345AYZ8_BPR18      MKYSVMQLKDFKIKSMDASVRASIREELLSEGFNLSEIELLIHCITNKPDDHTWLNEIIK
                      ****.***********************************************:*******

MODA_BPT4             SRLVPNDKPLWRGVPAETKQVLNQGIDIITFDKVVSASYDKNIALHFASGLEYNTQVIFE
F2VX42_9CAUD          SRLEPNDKPLWRGVPVETKQVLNQGIDIITFDKVVSASYDKNIALHFASGLEYNTQVIFE
A0A097J8J4_BPR51      SRLVPNDKPLWRGVPVETKQVLNQGIDIITFDKVVSASYDKNIALHFASGLEYNTQVIFE
A0A097J5E0_BPR27      SRLVPNDKPLWRGVPAETKQVLNQGIDIITFDKVVSASYDKNIALHFASGLEYNTQVIFE
A0A2K9VMH9_9CAUD      SRLVPNDKPLWRGVPVETKQVLNQGIDIITFDKVVSASYDKNIALHFASGLEYNTQVIFE
A0A345AYZ8_BPR18      SRLVPNDKPLWRGVPAETKQVLNQGIDIITFDKVVSASYDKNIALHFASGLEYNTQVIFE
                      *** ***********.********************************************

MODA_BPT4             FKAPMVFNFQEYAIKALRCKEYNPNFKFPDSHRYRNMELVSDEQEVMIPAGSVFRIADRY
F2VX42_9CAUD          FKAPMVFNFQEYAIKALRCKEYSPSFKFPDSHRYRNMELVSDEQEVMIPAGSVFRIADRY
A0A097J8J4_BPR51      FKAPMVFNFQEYAIKALRCKEYNPNFKFPDSHRYRNMELVSDEQEVMIPAGSVFRIADRY
A0A097J5E0_BPR27      FKAPMVFNFQEYAIKALRCKEYNPNFKFPDSHRYRNMELVSDEQEVMIPAGSVFRIADRY
A0A2K9VMH9_9CAUD      FKAPMVFNFQEYAIKALRCKEYSPSFKFPDSHRYRNMELVSDEQEVMIPAGSVFRIADRY
A0A345AYZ8_BPR18      FKAPMVFNFQEYAIKALRCKEYNPNFKFPDSHRYRNMELVSDEQEVMIPAGSVFRIADRY
                      **********************.*.***********************************

MODA_BPT4             EYKKCSTYTIYTLDFEGFNL
F2VX42_9CAUD          EYKKYSTYTIYTLDFEGFNL
A0A097J8J4_BPR51      EYKKYSTYTIYTLDFEGFNL
A0A097J5E0_BPR27      EYKKYSTYTIYTLDFEGFNL
A0A2K9VMH9_9CAUD      EYKKYSTYTIYTLDFEGFNL
A0A345AYZ8_BPR18      EYKKYSTYTIYTLDFEGFNL
                      **** ***************