CLUSTAL format seed alignment for MF_04146

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A0A2K8HNW7_9CAUD      ------------------------------------------------------------
A0A385INY4_9CAUD      ------------------------------------------------------------
TERL_BPT4             MEQPINVLNDFHPLNEAGKILIKHPSLAERKDEDGIHWIKSQWDGKWYPEKFSDYL---R
TERL_BPG20            ------------------------------------------------------------
TERL_BP234            ------------------------------------------------------------
TERL_BPT5             ------------------------------------------------------------
C3V1M6_9CAUD          MEQPINALNDFHPLNEAGKILIKHPSLAERKDEDGIHWIKSQWDGKWYPEKFSDYL---R
A0A346FJP4_BPT6       MEQPINALNDFHPLNEAGKILIKHPSLAERKDEDGIHWIKSQWDGKWYPEKFSDYL---R
A0A076YMX1_9CAUD      --MEMEPTIDPSKESDHPIGLMHPDYLKKKIDEAGMEWTQSEHDKKWYPTTFSDYL---K
A0A2Z5WKR5_9CAUD      ------------------------------------------------------------
Q8LTT3_9CAUD          --------------------MSSQKKKFKKKTINGIKYVQSNEDMQWYPRYLDDWKVLNR
A0A097J8X8_9CAUD      MEQPINALNDFHPLNEAGKILIKHPSLAERKDEDGIHWIKSQWDGKWYPEKFSDYL---R
Q9T1C3_BPRB4          --MSVIEGINAMATDEHPLHLAHPSTLETKIDSNGIEWILSKHDDKWYPKKFSDYL---K
                                                                                  

A0A2K8HNW7_9CAUD      -------------------------------------------------MKVSRDYINTT
A0A385INY4_9CAUD      -------------------------------------------------MKVSRDYINTT
TERL_BPT4             LHKIVKIPNNSDKPELFQTYKDKNNKRSRYMGLPNLKRANIKTQW---TREMVEEWKKCR
TERL_BPG20            -------------------------------------------------MKRLRPSDKFF
TERL_BP234            -------------------------------------------------MKRLRPSDKFF
TERL_BPT5             -------------------------------------------------MEVSRPYVNTV
C3V1M6_9CAUD          LHKIVKIPNNSDKPELFQTYKDKNNKRSRYMGLPNLKRANIKTQW---TREMVEEWKKCR
A0A346FJP4_BPT6       LHKIVKIPNNSDKPELFQTYKDKNNKRSRYMGLPNLKRANIKTQW---TREMVEEWKKCR
A0A076YMX1_9CAUD      VNAIHKVDLQSKDRSNFATYKDKSNKRSRYNGNPNLKRAYVQTKW---TKEMLMEWVRCR
A0A2Z5WKR5_9CAUD      ---------------------------------------------------MVEEWKKCR
Q8LTT3_9CAUD          MDKPHKLRIQSTDPSDFKTYKDKGNRRSRYMNIPNLRRANAPIRFGASMQDIKAEFQKCR
A0A097J8X8_9CAUD      LHKIVKIPNNSDKPELFQTYKDKNNKRSRYMGLPNLKRANIKTQW---TREMVEEWKKCR
Q9T1C3_BPRB4          LNRPXKIRMQSTDPTNYKFFKDSDNIRTRYMRLKNLRRANIKTQY---TPEMIAEWKRCR
                                                                               .  

A0A2K8HNW7_9CAUD      DVIDFGIDKRFFRLPVSSILAQEGITPNAPQVAIINALEDPRHRFVTACVSRRVGKSFIA
A0A385INY4_9CAUD      DVIDFGIDKRFFRLPVSSILAQEGITPNAPQIAIINALEDPRHRFVTACVSRRVGKSFIA
TERL_BPT4             DDIVYFAETYCAITHIDYGVIKVQLRDYQRDMLKIMSSKR-MTVCNLSRQLGKTTVVAIF
TERL_BPG20            ELLGYKPHHVQLAIHRSTAKRRVACLGRQSGKSEAASVEAVFELFARPGSQGWIIAPTYD
TERL_BP234            ELLGYKPHHVQLAIHRSTAKRRVACLGRQSGKSEAASVEAVFELFARPGSQGWIIAPTYD
TERL_BPT5             DVIDFGIDKRFFRLPVSGILAQEGITPNGPQIAIINALEDPRHRFVTACVSRRVGKSFIA
C3V1M6_9CAUD          DDIVYFAETYCAITHIDYGVIKVQLRDYQRDMLKIMSSKR-MTVCNLSRQLGKTTVVAIF
A0A346FJP4_BPT6       DDIVYFAETYCAITHIDYGVIKVQLRDYQRDMLKIMSSKR-MTVCNLSRQLGKTTVVAIF
A0A076YMX1_9CAUD      DDIVYFAETYCAITHIDYGTIKVQLRDYQKEMLIEMHKNR-MVACNLSRQLGKTTVVAIF
A0A2Z5WKR5_9CAUD      DDIVYFAETYCAITHIDYGVIKVQLRDYQRDMLKIMSSKR-MTVCNLSRQLGKTTVVAIF
Q8LTT3_9CAUD          DDIVYFAENYCSIVHIDLGNIKMVPRPYQKEMLEVADRSR-FSIFLLPRQLGKTTIMGIF
A0A097J8X8_9CAUD      DDIVYFAETYCAITHIDYGVIKVQLRDYQRDMLKIMSSKR-MTVCNLSRQLGKTTVVAIF
Q9T1C3_BPRB4          KDIVYFAETYCAITHIDYGTIKVQLRDYQKDMLKIMHENR-MSAHKLSRQLGKTTAVAIF
                      . : :  .        .    :                .        .            

A0A2K8HNW7_9CAUD      YTLGFLKLLEPNVKVLVVAPNYSLANIGWSQIRGLIKKYGLQTERENAKDKEIELANGSL
A0A385INY4_9CAUD      YTLGFLKLLEPNVKVLVVAPNYSLANIGWSQIRGLIKKYGLQTERENAKDKEIELANGSL
TERL_BPT4             LAHFVCFNKDKAVGILAHKGSMSAEVLDRTKQAIELLPDFLQPGIVEWNKGSIELDNGSS
TERL_BPG20            QAEIIFGRVVEKVERLSEVFPTTEVQLQRRRLRLLVHHYDRPVNAPGAKR-----VATSE
TERL_BP234            QAEIIFGRVVEKVERLAEVFPATEVQLQRRRLRLLVHHYDRPVNAPGAKR-----VATSE
TERL_BPT5             YTLGFLKLLEPNVKVLVVAPNYSLANIGWSQIRGLIKKYGLQTERENAKDKEIELANGSL
C3V1M6_9CAUD          LAHFVCFNKDKAVGILAHKGSMSAEVLDRTKQAIELLPDFLQPGIVEWNKGSIELDNGSS
A0A346FJP4_BPT6       LAHFVCFNKDKAVGILAHKGSMSAEVLDRTKQAIELLPDFLQPGIVEWNKGSIELDNGSS
A0A076YMX1_9CAUD      LAHFVCFNEDKFVGVLAHKASMSAEVLDRTKQAIELLPDFLQPGIVEWNKGSIELDNKCK
A0A2Z5WKR5_9CAUD      LAHFVCFNKDKAVGILAHKGSMSAEVLDRTKQAIELLPDFLQPGIVEWNKGSIELDNGSS
Q8LTT3_9CAUD          LAHYLVFNEDKEAGILAHKGSMSMEVLERVKNVIENLPDFLQPGIEEWNKGNITFDNGCK
A0A097J8X8_9CAUD      LAHFVCFNKDKAVGILAHKGSMSAEVLDRTKQAIELLPDFLQPGIVEWNKGSIELDNGSS
Q9T1C3_BPRB4          LAHYVCFNKDKAVGILAHKGSMAVEVLERTKQAIELLPDFLQPGIVEWNKKSIVLENGSS
                       :  .       .  *      :   :   :                 :         . 

A0A2K8HNW7_9CAUD      FKLASAAQADSAVGRSYDFIIFDEAAISDVGGAAFDIQLRPTLDKPNSKALFISTPRGGN
A0A385INY4_9CAUD      FKLASAAQADSAVGRSYDFIIFDEAAISDVGGAAFDIQLRPTLDKPNSKALFISTPRGGN
TERL_BPT4             IGAYASS-PDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLN
TERL_BPG20            FRGKSADRPDNLRGATLDFVILDEAAMIPF--SVWSEAIEPTLSVRDGWALIISTPKGLN
TERL_BP234            FRGKSADRPDNLRGATLDFVILDEAAMIPF--SVWSEAIEPTLSVRDGWALIISTPKGLN
TERL_BPT5             FKLASAAQADSAVGRSYDFIIFDEAAISDVGGDAFRVQLRPTLDKPNSKALFISTPRGGN
C3V1M6_9CAUD          IGAYASS-PDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLN
A0A346FJP4_BPT6       IGAYASS-PDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLN
A0A076YMX1_9CAUD      IGAFASS-PDAVRGNAFAMIYIDECAFIPNFQDAWLAIQPVISSGRKSKILITTTPNGLN
A0A2Z5WKR5_9CAUD      IGAYASS-PDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLN
Q8LTT3_9CAUD          LGAYASG-SDAVRGKSFSMIYVDECAFVPGFDDFWKATFPVISSGEESKVVLTSTPNGLN
A0A097J8X8_9CAUD      IGAYASS-PDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLN
Q9T1C3_BPRB4          IGAYASS-PDAVRGNSFSFIYIDECAFIQNWTDCFLAIQPVISSGRESKMIMTTTPNGLN
                      :   ::  .*   * :  :: .**.*:       :        .   .  :: :**.* *

A0A2K8HNW7_9CAUD      WFKEFYEKGF-------------NETLPNWVSIHGTYRDNPR-----ADLNDIEEARRTV
A0A385INY4_9CAUD      WFKEFYEKGF-------------NETLPNWVSIHGTYRDNPR-----ADLNDIEEARRTV
TERL_BPT4             HFYDIWTAAVEG-------KSGFEPYTAIWNSVKERLYNDED--IFDDGWQWSIQTINGS
TERL_BPG20            WFYEFFLMGWRGGLKEGIPNSGINQTHPDFESFHAASWDVWP-----ERREWYMERRLYI
TERL_BP234            WFYEFFLMGWRGGLKEGIPNSGVNQTHPDFESFHAASWDVWP-----ERREWYMERRLYI
TERL_BPT5             WFKEFYAYGF-------------DDTLPNWVSIHGTYRDNPR-----ADLNDIEEARRTV
C3V1M6_9CAUD          HFYDIWTAAVEG-------KSGFEPYTAIWNSVKERLYNDED--IFDDGWQWSIQTINGS
A0A346FJP4_BPT6       HFYDIWTAAVEG-------KSGFEPYTAIWNSVKERLYNDED--IFDDGWQWSIQTINGS
A0A076YMX1_9CAUD      HFYDIWNAAVEG-------KSGFVPYTAIWTSVKERLYTDGDDGVFDDGYSWSAKMIAGS
A0A2Z5WKR5_9CAUD      HFYDIWTAAVEG-------KSGFEPYTAIWNSVKERLYNDED--IFDDGWQWSIQTINGS
Q8LTT3_9CAUD          HYHDMWNAAVAG-------VSTFEPYTTTWRAVQNRLYKDGE---FDDGEAFKSETIGNT
A0A097J8X8_9CAUD      HFYDIWTAAVEG-------KSGFEPYTAIWNSVKERLYNDED--IFDDGWQWSIQTINGS
Q9T1C3_BPRB4          HFYDIWQSAIDG-------KSGYVPYEAVWHSVKERLYNKAD--IFDDGYEWSSQAIAGS
                       : :::  .                  . : :.:                    :     

A0A2K8HNW7_9CAUD      SKNYFRQEYEADFSVFEGQIFDTFNAIEH-----VKDLKGMRHFFKDDEAFETLLGIDVG
A0A385INY4_9CAUD      SKNYFRQEYEADFSVFEGQIFDTFNAIEH-----VKDLKGMRHFFKDDEAFETLLGIDVG
TERL_BPT4             SLAQFRQEHTAAFEGTSGTLISGMKLAVMDFIEVTPDDHGFHQFKKPEPDRKYIATLDCS
TERL_BPG20            PDLEFRQEYGAEFVSHSNSVFSGLDMLIL---LPYERRGTRLVVEDYRPDHIYCIGAD--
TERL_BP234            PDLEFRQEYGAEFVSHSNSVFSGLDMLIL---LPYERRGTRLVVEDYRPDHIYCIGAD--
TERL_BPT5             SKNYFRQEYEADFSVFEGQIFDTFNAIDH-----VKDLKGMRHFFKDDEAFETLLGIDVG
C3V1M6_9CAUD          SLAQFRQEHTAAFEGTSGTLISGMKLAIMDFIEVTPDDHGFHRFKSPEPDRKYIATLDCS
A0A346FJP4_BPT6       TLAQFRQEHTAAFEGTSGTLISGMKLAVMDFIEVTPDDHGFHRFKSPEPDRKYIATLDCS
A0A076YMX1_9CAUD      SKEAFLQEHCAEFMGTNGTLISGWKLSKMSWIDIDETETNFYQYKKPVEGHKYVAVLDPA
A0A2Z5WKR5_9CAUD      TLAQFRQEHTAAFEGTSGTLISGMKLAIMDFIEVTPDDHGFHRFKSPEPDRKYIATLDCS
Q8LTT3_9CAUD          SREAFSQEHLCNFLGTAGTLINGFKLSKMKGQDIVKDHDGWYVYKQPEENHKYILTVDTS
A0A097J8X8_9CAUD      TLAQFRQEHTAAFEGTSGTLISGMKLAVMDFIEVTPDDHGFHRFKSPEPDRKYIATLDCS
Q9T1C3_BPRB4          SLEQFLQEHNAEFFGSSGTLIRATTLSRLSFIDVVNDN-GFYQFEKPKEGRKYVATLDCS
                      .   * **: . *    . ::                              . :  :.  

A0A2K8HNW7_9CAUD      Y-RDPTAVLTIKYHYDTDVYYVLEEYQQA-----EKTTAQHAAYIQHCIDRYNVDRIFV-
A0A385INY4_9CAUD      Y-RDPTAVLTIKYHYDTDVYYVLEEYQQA-----EKTTAQHAAYIQHCIDRYNVDRIFV-
TERL_BPT4             EGRGQDYHALHIIDVTDDVWEQVGVLHSNTISHLILPDIVMRYLVEYNECPVYIELNSTG
TERL_BPG20            FGKNQDYSVFSVLDLDTGAIACLERMNGAT--WSDQVARLKALSEDYGHAYVVADTWG--
TERL_BP234            FGKNQDYSVFSVLDLDTGAIVCLERMNGAT--WSDQVARLKALSEDYGHAYVVADTWG--
TERL_BPT5             Y-RDPTAVLTIKYHYDTDTYYVLEEYQQA------EKTTAQHAAYIQHCIDRYKVDRIFV
C3V1M6_9CAUD          EGRGQDYHALHIIDVTDDVWEQVGVLHSNTISHLILPDIVMRYLVEYNECPVYIELNSTG
A0A346FJP4_BPT6       EGRGQDYHALHIIDVTDDVWEQVGVLHSNTISHLILPDIVMRYLVEYNECPVYIELNSTG
A0A076YMX1_9CAUD      EGRGQDYHAMHIIDITTLPFEQVAVYHSNKTSHLILPDILLRYLNMYNEAWIYIELNSTG
A0A2Z5WKR5_9CAUD      EGRGQDYHALHIIDVTDDVWEQVGVLHSNTISHLILPDIVMRYLVEYNECPVYIELNSTG
Q8LTT3_9CAUD          EGRGQDYHALHMIDVTSYPFEQVAVFHDNKTSHLLLPAIIMKQAYRYNEAYVYCEIASTG
A0A097J8X8_9CAUD      EGRGQDYHALHIIDVTDDVWEQVGVLHSNTISHLILPDIVMRYLVEYNECPVYIELNSTG
Q9T1C3_BPRB4          EGRGQDYHALQIIDITEFPYKQVAVYHSNTTSHFILPDIVFKYLMMYNECPVYIELNSTG
                        :.         .        :   :                    .    *       

A0A2K8HNW7_9CAUD      DSAAAQFRQDLAYEHEIASAPAK-----KSVLDGLACLQALFQQGKIIVDASCTSLIHAL
A0A385INY4_9CAUD      DSAAAQFRQDLAYEHEIASAPAK-----KSVLDGLACLQALFQQGKIIVDASCTSLIHAL
TERL_BPT4             VSVAKSLYMDLEYEGVICDSYTD-----LGMKQTKRTKAVGCSTLKDLIEKDKLIIHHRA
TERL_BPG20            VGDAIAEELDAQGINYTPLPVKS-----SSVKEQLISNLALLMEKGQVAVPNDKTILDEL
TERL_BP234            VGDAIAEELDAQGINYTPLPVKS-----SSVKEQLISNLALLMEKGQVAVPNDKTILDEL
TERL_BPT5             DSAAAQFRQDLAYEHEIASAPAK-----KSVLDGLACLQALFQQGKIIVDASCSSLIHAL
C3V1M6_9CAUD          VSVAKSLYMDLEYEGVICDSYTD-----LGMKQTKRTKAVGCSTLKDLIEKDKLIIHHRA
A0A346FJP4_BPT6       VSVAKSLYMDLEYEGVICDSYTD-----LGMKQTKRTKAVGCSTLKDLIEKDKLIIHHRA
A0A076YMX1_9CAUD      HSVAKSLFSELEYENVICDSYND-----LGMKQTKRSKAMGCSTLKDLIEKDKLIINNKK
A0A2Z5WKR5_9CAUD      VSVAKSLYMDLEYEGVICDSYTD-----LGMKQTKRTKAVGCSTLKDLIEKDKLIIHHRA
Q8LTT3_9CAUD          ELVMNELFRDLEYENVIMEERASGGRRGLGLKPNKKTKAIGCSTLKDLIEKDQLKINHIP
A0A097J8X8_9CAUD      VSVAKSLYMDLEYEGVICDSYTD-----LGMKQTKRTKAVGCSTLKDLIEKDKLIIHHRA
Q9T1C3_BPRB4          VSIAKSLAMDLEYDNIICDSFID-----LGMKQSKRSKAMGCSALKDLIEKDKLIINHKG
                               :            .      .:                :   .   : .  

A0A2K8HNW7_9CAUD      ANYKWDFQEGEEKLSREKPR--HDANSHLCDALRYGIYSISRGK----------------
A0A385INY4_9CAUD      ANYKWDFQEGEEKLSREKPR--HDANSHLCDALRYGIYSISRGK----------------
TERL_BPT4             TIQEFRTFSEKGVSWAAEEGYHDDLVMSLVIFGWLSTQSKFIDYADKDDMRLASEVFSKE
TERL_BPG20            RNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYEGKDGYKFELAEERPSKLKHEESV
TERL_BP234            RNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYEGKDGYKFELAEERPSKLKHEESV
TERL_BPT5             QNYKWDFQEGEEKLSREKPR--HDANSHLCDALRYGIYSISRGK----------------
C3V1M6_9CAUD          TIQEFRTFSEKGVSWAAEEGYHDDLVMSLVIFGWLSTQSKFIDYADKDDMRLASEVFSKE
A0A346FJP4_BPT6       TIQEFRTFSEKGVSWAAEEGYHDDLVMSLVIFGWLSTQSKFIDYADKDDMRLASEVFSKE
A0A076YMX1_9CAUD      TILEFRTFSEKGVSWAAEEGFHDDLVMSLACFGWLTTQMKFAEFCEKDDLRLANEVFARE
A0A2Z5WKR5_9CAUD      TIQEFRTFSEKGVSWAAEEGYHDDLVMSLVIFGWLSTQSKFIDYADKDDTRLASEVFSKE
Q8LTT3_9CAUD          TLKEFHTFVEKGKSWEAEEGFHDDLVMSLTLLAYLSTQDRFSDFVDK-EYNVSYDIFKQE
A0A097J8X8_9CAUD      TIQEFRTFSEKGVSWAAEEGYHDDLVMSLVIFGWLSTQSKFIDYADKNDMRLASEVFSKE
Q9T1C3_BPRB4          TIQELRTFSEKGVSWAAEEGFHDDLVMSLVIFGWLTTQEKFAEYAGKDEMRIASEIFRKE
                         .                 . :  :. .                              

A0A2K8HNW7_9CAUD      ---------------------------------
A0A385INY4_9CAUD      ---------------------------------
TERL_BPT4             LQDMSDDYAPVIFV-DSVHSAEYVPVSHGMSMV
TERL_BPG20            MSLVEDDFTDLELANRAFSA-------------
TERL_BP234            MSLVEDDFTDLELANRAFSA-------------
TERL_BPT5             ---------------------------------
C3V1M6_9CAUD          LQDMGDEYAPVIFV-DSVHSAEYVPVSHGMSMV
A0A346FJP4_BPT6       LQDMSDDYAPVIFV-DSVHSAEYVPVSHGMSMV
A0A076YMX1_9CAUD      REQLYEDALCPVIV-TSGDETISVG-SHGISFI
A0A2Z5WKR5_9CAUD      LQDMSDDYAPVIFV-DSVHSAEYVPVSHGMSMV
Q8LTT3_9CAUD          VHDMMDDDVPFIMIADGVDNYGTDFSMNGFGMF
A0A097J8X8_9CAUD      LQDMGDEYAPVIFV-DSVHSAEYVPVSHGMSMV
Q9T1C3_BPRB4          LDELGEEYAPVVIY-DGANGIEEYRPREGLTMI