CLUSTAL format seed alignment for MF_04147

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TERL_BPT3             ---MSTQSNRNALVVAQLKGD--FVAFLFVLW-KALNL--PVPTKCQIDMAKVLANG---
TERL_BPT7             ---MSTQSNRNALVVAQLKGD--FVAFLFVLW-KALNL--PVPTKCQIDMAKVLANG---
M1PW71_9CAUD          ------MRATKDALEAKLKGE--FKTFLAAVW-HELGL--PSPTRAQYAIADYLQHG---
I6Q9Q6_9CAUD          ---MSTQSNRNALVVAQLKGD--FVAFLFVLW-KALNL--PVPTKCQIDMAKVLANG---
A0A219YHD1_9CAUD      -----------------------------MLW-KALNL--PEPTKCQIDMAKCLADP---
A0A1T5BR17_9SPHN      ------MTDQSLTAEGRLKAS--FTLFLIYVWVRVLRL--PRPTRVQLDIADYLANG---
A0A3A6W2V7_9FIRM      -------MEWTEEQIAKAKED--FRVFIYMVW-KMISL--PDPTPIQYDIAHTLQNL---
M1IPT5_9CAUD          -------------MDKRLKN---FKNFLYLCW-KHLNL--PNPTPIQFDIADYLQSN---
D1L2X6_9CAUD          -------------------------------------------------MAKCLANP---
M1PKP4_9VIRU          ------MPDKHQQIIKEAIDS--FPVFATHLW-HFLRL--PSPTPVQYQLADYLQNG---
A0A1Y0SYB4_9CAUD      MMTKKNQAQMNKENIGLLKGN--FVAFMFVVW-AALGL--PKPTKCQIDMAKTLADA---
A0A140XFQ2_9CAUD      ---MSTQANKNALIVAQLKGD--FVAFLFVLW-KALNL--PKPTKCQIDMARTLANG---
A0A2D2W5F3_9CAUD      ----------MTTKQHPAQKD--FRVFMFMVW-RHLNL--PEPTPVQYDIAHYLQHG---
A0A0E3JQM8_9CAUD      --MSDTQANRNALIIAQLKGD--FVAFLFVLW-KALAL--PPPTKCQIDMARCLANG---
A0A1B2ANE0_9CAUD      -------MKPDSKHIKLLKGN--FVAFLFVLW-AALNL--PVPTKQQISMSKKLAAG---
A0A4Y1NTW0_9CAUD      -----------MKVPAKLKI---FKNFLYLAW-KHLQL--PPPTKIQYDMADFLQYG---
E3SME4_9CAUD          -----------MQIQQQLKDD--FRYFLTAVW-THLAL--PAPTRAQLCIAEYLQNG---
M4NK29_9CAUD          ----------MTDVLTALQED--FKLFLQALW-GQLDL--PEPTRAQYAIADYLQSG---
A0A516MQ45_9VIRU      --------MYSDKYMKGLEKD--FRNFCHHIW-KSLDL--PPLTPVQNDIAWYLQHG---
A0A1W6JS52_9CAUD      ----MSKPRNGADDLELIKRS--FVAFLFVLW-RALNL--PKPTKCQIDMAKKLSAG---
A0A516LVT9_9VIRU      -----MMSLLQPQIPNELKD---FRNFLYFIW-HSLEQIKRDPTDIQYDIADFMQHG---
A0A516LLN2_9VIRU      ----------MVNVDPRLQGRDGFKNWLYLAW-GALGL--PEPTRIQYDIGDFLANG---
A0A060BK33_9CAUD      --MGVYDKTITQEELKVYVND--FREYLKYVW-EGINL--PEPTPIQIDMARTLMVG---
A0A516LV17_9VIRU      -------------MDQRLTD---FRNFLYLAW-DHLRL--PDPTPIQYDIAEYLQNG---
A0A516M395_9VIRU      ----MTWLPQNPNVPKELQGDRGFCNFLYLAW-HAIDL--PDPTPVQYDIAYFMQHGGDT
M4NUY4_9CAUD          -------------------------MFLQALW-AQLDL--PNPTRAQYAIADYLQHG---
                                                                       :.  :      

TERL_BPT3             -DNKKFILQAFRGIGKSFITCAFVVWTLWRDPQLKILIVSASKERADLNSIFIKNIIDL-
TERL_BPT7             -DNKKFILQAFRGIGKSFITCAFVVWSLWRDPQLKILIVSASKERADANSIFIKNIIDL-
M1PW71_9CAUD          -P-KRLQVQAFRGIGKSYVTAAYVLWELYKDPNIKVMCISASKERADANSIFLQKLILT-
I6Q9Q6_9CAUD          -DNKKFILQAFRGIGKSFITCAFVVWSLWRDPQLKILIVSASKERADANSIFIKNIIDL-
A0A219YHD1_9CAUD      -KNKKFILQAFRGIGKSFITCAFVVWTLWRDPQLKILIVSASKERADANSIFIKNIIDL-
A0A1T5BR17_9SPHN      -P-RRRFIAAFRGVGKTFLSAAYIVWRLWNNPDAKIMVVSANERFAAKIAAFIHTIINAE
A0A3A6W2V7_9FIRM      -PNDRFIIEGFRGVAKSFITCAYAVWTLWRDPQKKVEIVSASKDRADANAIFIKRIIYT-
M1IPT5_9CAUD          -E-KRLVIEAFRGVGKSWITSAFVCHQLLLNPQKNILVVSASKTRADDFSTFTQRLIGE-
D1L2X6_9CAUD          -KNKKFILQAFRGIGKSFITCAFVVWTLWRDPQLKILIVSASKERADANSIFIKNIIDL-
M1PKP4_9VIRU          -P-NRRIIMAYRGCGKSFLTAGYVLWRLRKNPDTKVLVISAAQDRADAFSVFCHDLLRN-
A0A1Y0SYB4_9CAUD      -SRTRFILQAFRGIGKSFITCAFVVWLLWNNPQLKILIVSASKQRADDNSTFIKNIINL-
A0A140XFQ2_9CAUD      -DHKKFILQAFRGIGKSFITCAFVVWVLWRDPQLKVLIVSASKERADANSIFIKNIIDL-
A0A2D2W5F3_9CAUD      -P-RRSVIEAFRGVGKSWITSALVCWVLWNDPQKKILVISASKERADAFSTFVKRLINE-
A0A0E3JQM8_9CAUD      -DNKKFILQAFRGIGKSFITCAFVVWTLWRDPQLKILIVSASKERADANSIFIKNIIDL-
A0A1B2ANE0_9CAUD      -DSRRFILQAFRGIGKSFITCAFVVWKLWNNPDLKIMIVSANKDRADANSVFIKRIIDL-
A0A4Y1NTW0_9CAUD      -P-KRSCVQAFRGAGKSWITSAFACWNWLMDPQKNILVVSASKTRADDFSTFTQRLIHE-
E3SME4_9CAUD          -P-KRLQIQAFRGVGKSWITAAFVLWTLYNNSDKKIMVVSASKDRADSFSIFCQRLILE-
M4NK29_9CAUD          -P-KRLQIQAFRGVGKSWITGAFVLWTLFKDSEKKIMIISASKERADNMSIFLQKLIIE-
A0A516MQ45_9VIRU      -P-ERCIVEAFRGVGKSYLTAAYVCWKLKYNRDLEILVVSAGKDRADAFAIFVRNLIRN-
A0A1W6JS52_9CAUD      -DERRFILQAFRGIGKSFITCAFVVWKLWNNPDLKFMIVSASKERADANSVFIKRIIDL-
A0A516LVT9_9VIRU      -P-KRAVVQGFRGVGKSWICSAFVVHQLFLDPAKNILVVSASKTRSDDFSTFTLRLIHD-
A0A516LLN2_9VIRU      -P-RRCVIQAFRGVGKSYITSAYVVWRLLLDPSLNFLVISASKNRSDDFSTFSLRLIEE-
A0A060BK33_9CAUD      -D-KRMLLEAFRGVGKTYITGAYVTWRLLRNPNEKVLIVSQSGPHSEAIAQFVRRLIFD-
A0A516LV17_9VIRU      -P-RRICIQAFRGVGKSWITSAFVCHQLLLDPSKNILVVSASKQRADDFSTFTLRLIEE-
A0A516M395_9VIRU      SS-DRVAVQAFRGVGKSYIAAAYVVWVLLLDPSKIIQVISGSKVRADDLTNFTLQLIGS-
M4NUY4_9CAUD          -P-KRLQIQAFRGVGKSWITGAFVLWTLFNNAEKKIMIISASKERADNMSIFLQKLIIE-
                          .  : .:** .*:::  .   .    :    .  :*     :   : *   ::   

TERL_BPT3             -------L-PFLDELKPSPGQ--RDSVISFDVGPAKPDHSPSVKSVGITGQLTGSRADII
TERL_BPT7             -------L-PFLSELKPRPGQ--RDSVISFDVGPANPDHSPSVKSVGITGQLTGSRADII
M1PW71_9CAUD          -------I-PWLKHMRPSNDEA-RWSRVSFDIGGCTPTQAPSVKSVGISGNMTGSRADIM
I6Q9Q6_9CAUD          -------L-PFLAELKPRPGQ--RDSVISFDVGPAKPDHSPSVKSVGITGQLTGSRADII
A0A219YHD1_9CAUD      -------L-PFLSELKPRPGQ--RDSVISFDVGPAKPDHSPSVKSVGITGQLTGSRADII
A0A1T5BR17_9SPHN      DVVSLEPV-PW-SELKARAKQ--KNSTMEFDVGPAMPDKDYSVSAFGITGQITGGRADLI
A0A3A6W2V7_9FIRM      -------L-PFLAHLKARPDQ--RDQQNLFDVGPAVPDISPSIKSVGISGQLTGSRADLL
M1IPT5_9CAUD          -------M-PLLQHLIPRDNQ--RHSKVSFDVAPALASHAPSVKSMGITGQLTGSRADII
D1L2X6_9CAUD          -------L-PFLSELKPRPGQ--RDSVISFDVGPAKPDHSPSVKSVGITGQLTGSRADII
M1PKP4_9VIRU          -------W-FMVKDLFPSDTQ--RFSKVAFDVYGSKPDQSPSVRSSGIFGQITGSRADLI
A0A1Y0SYB4_9CAUD      -------L-PFLHELKPQAGQ--RDSVIAFDVGGATPDHSPSVKSVGITGQLTGSRADII
A0A140XFQ2_9CAUD      -------L-PFLAELKPRPGQ--RDSVISFDVGLAKPDHSPSVKSVGITGQLTGSRADII
A0A2D2W5F3_9CAUD      -------L-PVLQHLKPKADQ--RDSMISFDVGPATPDHSPSVKSVGINGQITGSRADII
A0A0E3JQM8_9CAUD      -------L-PFLAELKPRPGQ--RDSVISFDVGPAKPDHSPSVKSVGITGQLTGSRADII
A0A1B2ANE0_9CAUD      -------L-PFLHELKPRPGQ--RDSSLSFDVGPARPDHSPSVKSVGVTGGMTGSRADIL
A0A4Y1NTW0_9CAUD      -------L-PILEHLKPREDQ--RSSKVSFDVGPARASHAPSCKSMGITSQLTGSRADLI
E3SME4_9CAUD          -------V-PWMSHLKPKNDDQ-RWSRVSFDVGPAAPHQAPSVKSVGITGQLTGSRADLM
M4NK29_9CAUD          -------T-PWLSHLKPKSDDA-RWSRISFDVN-CSPHQAPSVKSVGITGQLTGSRADLM
A0A516MQ45_9VIRU      -------V-DILKHMEPDKNKGHRATQNIFDVNGRTTSGSPSVKSVGITGQITGSRADII
A0A1W6JS52_9CAUD      -------L-PFLHELKPGPGQ--RDSSLAFDVGPAKPDHSPSVKSVGITGQLTGSRADIL
A0A516LVT9_9VIRU      -------I-PLLSFLKPTADQ--RFSKVSFDVGPAGASHAPSVKSLGITSQLTGSRADII
A0A516LLN2_9VIRU      -------MGQLTAHLRPRENQ--RCSKVAFDVGPAPPAHAPSVTSKGVFSSITGARATEI
A0A060BK33_9CAUD      -------L-PILEHLIPSSEM--RNSVKSFDVSGCEVTVQPSVKSLGITSQLQGNRASIL
A0A516LV17_9VIRU      -------M-PILQHLKPNENQ--RNSKIAFDVGPAPASHAPSVTSRGITSQITGQRADLI
A0A516M395_9VIRU      -------LGPLTEHLIPREGQ--RQSRIAFDVGCAPNQKDPSVTSKGLFSQLTGGRADLI
M4NUY4_9CAUD          -------T-PWLAHMRPKSDDS-RWSRVSFDIN-CSPHQAPSVKSVGITGQLTGSRADLM
                                    : .      .     **:         *  : *: . : * **  :

TERL_BPT3             IADDVEIPSNSATQGAREKLWTLVQEFRALLKPLPTSRVIYLGTPQTEMTLYKELEDNRG
TERL_BPT7             IADDVEIPSNSATMGAREKLWTLVQEFAALLKPLPSSRVIYLGTPQTEMTLYKELEDNRG
M1PW71_9CAUD          LFDDVEVPGNSATDMLREKLLQLISEAEAILMPKPTSRILFLGTPQTTFTVYRKLSE-RG
I6Q9Q6_9CAUD          IADDVEIPSNSATMGAREKLWTLVQEFAALLKPLTSSRVIYLGTPQTEMTLYKELEDNRG
A0A219YHD1_9CAUD      IADDVEIPGNSATQGAREKLWTLVQEFAALLKPLPTSRVIYLGTPQTEMTLYKELEDNRG
A0A1T5BR17_9SPHN      LFDDIEVPNNSETEAMREKLVDRAAEAAAILKP--DGEVVYLGTFQSMASIYRNLRS-KG
A0A3A6W2V7_9FIRM      IADDVEVANNSGTQTQRDKLNEAVKEFDAIIKP--KGQIVYLGTPQNEMSLYNELQQ-RG
M1IPT5_9CAUD          IADDVESANNSQTQLMRDRLSETVKEFDAIIKP-NTGRIIFLGTPQNEMSLYNSLEE-RG
D1L2X6_9CAUD          IADDVEIPGNSATQGAREKLWTLVQEFAALLKPLPTSRVIYLGTPQTEMTLYKELEDNRG
M1PKP4_9VIRU          VADDVETPQSCETQLIRDKLRESIKEFDSIIKP--GGQIVFLGTPHTQDSIYGKLEL-AG
A0A1Y0SYB4_9CAUD      IADDVEIPSNSATQGAREKLWTLVQEFAALIKPLESSRIIYLGTPQTEMTLYKELEDNRG
A0A140XFQ2_9CAUD      IADDVEVPGNSSTSSAREKLWTLVTEFAALLKPLPTSRVIYLGTPQTEMTLYKELEDNKG
A0A2D2W5F3_9CAUD      IADDVEVPNNSATQMMRDKLSEAVKEMDAVIKPLQTSRIIYLGTPQTEMSLYNALPE-RG
A0A0E3JQM8_9CAUD      IADDVEIPSNSATQGAREKLWTLVQEFAALLKPLPTSRVIYLGTPQTEMTLYKELEDNRG
A0A1B2ANE0_9CAUD      IADDVEVPGNSGTQSARDHLGELVKEFDAILKP--DGTIIYLGTPQTEMTLYRELED-RG
A0A4Y1NTW0_9CAUD      IADDVESANNSQTQLMRDRLSETIKEFDSIIKP-EVGRIIFLGTPQTELSIYNQLEE-RG
E3SME4_9CAUD          VLDDVEVPNNSMTELQREKLLQLVTECESILTPKKDSRIMFLGTPQTTFTVYNKLRE-RA
M4NK29_9CAUD          ILDDIEVPGNSMTEFMREKLLQLCTEAESILTPKEDSRIMYLGTPQTTFTIYRKLAE-RN
A0A516MQ45_9VIRU      IADDIEVVSNSATHDLREKLARLVTEFDAVIKP--NGRNIYLGTPQTEMSLYNTLYN-RG
A0A1W6JS52_9CAUD      IADDVEVPNNSATQTARDHLGELVKEFDAILKP--GGTIIYLGTPQTEMTLYRELEG-RG
A0A516LVT9_9VIRU      IADDVEVANNSATQQMRDKLSEQIKEFDAIIKPHEEARIIVLGTPQCEDSLYTKLQE-RG
A0A516LLN2_9VIRU      ICDDVASWANSQTQMMRDKLAAATAEYEAILKP--GGRIIYLGTPQTEQDILKELPE-RG
A0A060BK33_9CAUD      ISDDVEGLQNSATEQMRAKLLATVAXXXX-----------XLGTPQSGESIYNKMRD-KG
A0A516LV17_9VIRU      ISDDAESLNNSATSGMRDKLVTATKEFEAVIKP--EGRIIFLGTPQTEMSIYSSLPE-RG
A0A516M395_9VIRU      IPDDIITKQNSLTQAMRDKIKDAAEEFNAILKP--SGRIVYLMTPQSEADLAHELPD-MG
M4NUY4_9CAUD          ILDDIEVPGNSMTELMREKLLQLCTEAESILTPKEDSRIMYLGTPQTTFTVYKRLAE-RS
                      : **     .. *   * .:                     * * :    :   :     

TERL_BPT3             YTTIIWPALYPRSREEDLYY------GERLAPMLREEFNDGFEMLQ-------GQPTDPV
TERL_BPT7             YTTIIWPALYPRTREENLYY------SQRLAPMLRAEYDENPEALA-------GTPTDPV
M1PW71_9CAUD          YRPFVWPSRYPDK---PELY------EGTLAPLLEADLEAGAKP---------GDPTD-S
I6Q9Q6_9CAUD          YTTIIWPALYPRTREENLYY------SQRLAPMLRAEYDENPEALA-------GTPTDPV
A0A219YHD1_9CAUD      YSTIIWPAQYPRSKEEDLYY------GDRLAPMLRSEYDDDKEGLS-------SQPTDPV
A0A1T5BR17_9SPHN      YGMRLWPARYPTK-DKLHLY------EDTLAPLLKEDIAQDPGLMTPGASSLGGAPTDPA
A0A3A6W2V7_9FIRM      YRCRIWTVLYPESLSEREFY------GDRLAKIIADKYDNNPELYA-------GKPTDPR
M1IPT5_9CAUD          FKTKIWTALVPNQ-TQKISY------GHKLADII-----QGTE----------GDPTDPK
D1L2X6_9CAUD          YSTIIWPAQYPRSKEEDLYY------GDRLAPMLRSEYDEDKEGLS-------SQPTDPV
M1PKP4_9VIRU          YTPRIWTALYPTARKRKDYY------QHRLAPKIASDLDKDASL-A-------GHPVDPE
A0A1Y0SYB4_9CAUD      YSTVIYPALYPRTKEEELFY------GDRLAKLLRDEYVENPELLR-------GEPTDPV
A0A140XFQ2_9CAUD      YSTVIWPAQYPRNESEALYY------GDRLAPMLKQEYDEGYEILR-------GQPTDPV
A0A2D2W5F3_9CAUD      YEARIWPALYPEL-HLVANY------KGHLAPFITRALEADKSL-V-------GAPTDPR
A0A0E3JQM8_9CAUD      YTTIIWPALYPRSREEDLYY------GDRLAPMLREEFNDGFEMLQ-------GQPTDPV
A0A1B2ANE0_9CAUD      YTTTIWPARYPRDQADLESYWHAKGNRSRLDPGMLAELEADPRLF--------WKPTDPI
A0A4Y1NTW0_9CAUD      FKTQIWPARFPDS-KAIINY------GHKLAESILKNKDKFKP----------GQALDPD
E3SME4_9CAUD          YKPFVWPARYPRK---VAMY------DGLLAPQLEKDLNNDSEL-T-------WVPTD-T
M4NK29_9CAUD          YRPFVWPARVPRS---LSNY------EGLIAPQLQEDIDMGAEA---------WDVTDPD
A0A516MQ45_9VIRU      YEVRIWCAQVPTE-QQALSY------GPKLAPFIRKMMETKDA----------GTTTD-T
A0A1W6JS52_9CAUD      YVTTIWPARYPKDQADWDSY------GPRLAPMLAAELQADGSLF--------WAPTDEV
A0A516LVT9_9VIRU      FTTKIWSAEKVEPKKAMNTY------GDTLSTLC---IDEDTQ----------GDSAEPT
A0A516LLN2_9VIRU      FKTRIWPAKVPTA-KQKTNY------GEMLAPSIQEMEEPS------------GTPTDPK
A0A060BK33_9CAUD      FRTIVYPARFPED---VEVY------KGCLADYVAIPLENGTKK-P-------GEITD-F
A0A516LV17_9VIRU      YNVAIWPARYPDE-KTSQSL------GDRLAPKIQSDLKADGEL-V-------GKPTDPQ
A0A516M395_9VIRU      YDVRIWPVEIPPD-SVAKNQ------GSRLAPLILKMIEDGVMV---------GTPTDPL
M4NUY4_9CAUD          YKPFVWPARYPRK---TTNY------EGLLAPQLVEDLEHGAEK---------WDVTD-D
                      :   ::                       :                           :  

TERL_BPT3             RFDMEDLRERELEYGKAGFTLQFMLNPNLSDAEKYPLRLRDAIVCG--LDFEKAPMHYQW
TERL_BPT7             RFDRDDLRERELEYGKAGFTLQFMLNPNLSDAEKYPLRLRDAIVAA--LDLEKAPMHYQW
M1PW71_9CAUD          RFSDIELMEREASMGRSNFELQFQLNTTLSDADKFPLRFSDFIITP--LGGE-CAEKYSW
I6Q9Q6_9CAUD          RFDRDDLRERELEYGKAGFTLQFMLNPNLSDAEKYPLRLRDAIVAA--LDLEKAPMHYQW
A0A219YHD1_9CAUD      RFDSMDLQEREVEYGKAGYTLQFMLNPNLSDAEKYPLRLRDAIVCG--LQMDKAPMHYQW
A0A1T5BR17_9SPHN      RFTELDLMEREVEWGSGGFQLQFMLDTSLVDADRFPLKTRDLIIMD--TARDVAPMRVAW
A0A3A6W2V7_9FIRM      RFDEEEIYKRRLSYGKAGFALQFMLNTNLSDQEKYPLKVQDLMIAN--LSLDEANLKWYW
M1IPT5_9CAUD          RFDAVDLMERLSSYGRSGFNLQFMLDTSLSDANRYPLKLNDLIVASGCSTWKDAPAKIQW
D1L2X6_9CAUD          RFDSMDLQEREVEYGKAGYTLQFMLNPNLSDAEKYPLRLRDAIVCG--LQADKAPMHYQW
M1PKP4_9VIRU          RFNWEELEARKESIGRSTFNLQFLLDISLSDEERYPLKLMDLCIFR--LNREQGPDKVVW
A0A1Y0SYB4_9CAUD      RFDKEELRGRELEYGKAGFTLQFMLNPNLTDAARYPLRLRDLIVGD--LSDSTSPLIYQW
A0A140XFQ2_9CAUD      RFDMDDLRERELEYGKAGYTLQFMLNPNLSDAEKYPLRLRDAIVCA--VDPERAPLSYQW
A0A2D2W5F3_9CAUD      RFNETDLLERKASYGRAGFALQFMLDTSLSDGDRYPLKIADLIVQN--LNPTMAHVKIAW
A0A0E3JQM8_9CAUD      RFDMEDLRERELEYGKAGFTLQFMLNPNLSDAEKYPLRLRDAIVCG--LDFEKAPMHYQW
A0A1B2ANE0_9CAUD      RFDEEDLRERELSYGKGGFALQFMLNPNLSDIEKYPLKLRDWIVAA--LDMASAPTTWQW
A0A4Y1NTW0_9CAUD      RFDDVDLMEREASYGRSGFSLQFMLDTTLSDVNKYPLKLNDLIIMSGISSWEEAPGKLQW
E3SME4_9CAUD          RFREEDLLERESAMGRSNFMLQFMLDTSLSDAEKFPLKFADLIINP--VNPETAPENIIW
M4NK29_9CAUD          RFSDDDLIEREAAMGRSNFMLQFMLDTSLSDADKFPLKMQDLVVTS--VNPTTAPDSVIW
A0A516MQ45_9VIRU      RFTDEDLAKRLLSYGRSGFALQFMLDTSLSDADKFPLKIDDLIISH---VGEKLPNEIYW
A0A1W6JS52_9CAUD      RFDDKDLRERELSYGKGGFALQFMLNPNLSDMEKYPLKLRDFIVGT--FAQDKGPTTLIW
A0A516LVT9_9VIRU      RFTNFDLQERKISYGSAGYAMQFMLNPNLADVDRYPLKLGNLVVQD--IDQDVAPEKIVW
A0A516LLN2_9VIRU      RFDGDDLLERELSYGRTMFNLQFMLDQSLSDLDRYPLKINDLMVTD--LDSDKCYEKYVW
A0A060BK33_9CAUD      RFTHEDLVEREASIGKSWFRLQYQLDTTLSDADKHPLKTSDIIVHD--LDIKTGPISISY
A0A516LV17_9VIRU      RFDDIDLMEREASYGRTGFALQFMLDTSLSDQNRYPLKLSDLIVMN--LNPDNAPEKVIW
A0A516M395_9VIRU      RFDEDDLEKRRAGYGRTGYAMQFLLDQSLADAERFPLKLPDLIVDN--LNPEMCYEKYAW
M4NUY4_9CAUD          RFDNEDLIEREASMGRSNFMLQFMLDTSLSDADKFPLKCADLVVTS--VNPKSAPESVVW
                      **   ::  *    *   : :*: *: .* *  ..**.  :  :               :

TERL_BPT3             LPNRQN---RNEELPNVGLKGDDIHSYHSCSQNTGQYQQRILVIDPSGRGKDETGYAVLF
TERL_BPT7             LPNRQN---IIEDLPNVGLKGDDLHTYHDCSNNSGQYQQKILVIDPSGRGKDETGYAVLY
M1PW71_9CAUD          SCDPRY---VLKDLPAVGLPGDRWYSPMFIDSAACDYSETIVSIDPSGRGLDETVAVVMS
I6Q9Q6_9CAUD          LPNRQN---IIEDLPNVGLKGDDLHTYHDCSNNSGQYQQKILVIDPSGRGKDETGYAVLY
A0A219YHD1_9CAUD      LPNRQN---RNEELPNVGMKGDEIYSFHTASSNTGAYQGKILVIDPSGRGKDETGWCVLY
A0A1T5BR17_9SPHN      GSAPEQ---LVKDMDNIGFDGDRMFRPIYKSQEWVPYTGSVLEIDPSGTGTDETAYVITK
A0A3A6W2V7_9FIRM      SNDRQL---RINDLPCVALKGDYFYEPQGRSNEVFEYTGTVMAVDPSGRGKDETSYAVVK
M1IPT5_9CAUD          ASSPEQMKAIDPDIPNVGLKGDYFVAPMMMSEEFTAFEGTVMSIDPSGRGEDKTAYAVLK
D1L2X6_9CAUD          LPNRQN---RNEELPNVGMKGDEIYSFHTASSNTGAYQGKILVIDPSGRGKDETGWCVLY
M1PKP4_9VIRU          LANGD----KALDLPSVGLHGDLFYKPAQIGSEFIDYTGVVLAVDPSGRGSDELGYAVVA
A0A1Y0SYB4_9CAUD      LPHASN---LIQSLPNVGLKGDTYHNWHSTSHHVGEYTRKILVVDPSGRGSDETGWCILY
A0A140XFQ2_9CAUD      LPNRQN---RNEELPNVGLKGDDIHSFHTCSSRTAEYQSKILVIDPSGRGKDETGYAVLY
A0A2D2W5F3_9CAUD      AAAPEV---CINDLPAVALTGDRYYRPMWTDQQMSEYTGCVMAIDPSGRGADETGYAIIK
A0A0E3JQM8_9CAUD      LPNRQN---RNEELPNVGLKGDDIHSYHSCSQNTGQYQQRILVIDPSGRGKDETGYAVLF
A0A1B2ANE0_9CAUD      LPNDRN---EAKGLPLVGLKGDRFHRYESCGTTTAAYEQKILVIDPSGRGKDETGYAVLY
A0A4Y1NTW0_9CAUD      ANSLDQIKALDPEIPNVGLKGDYYVAPMHVSNDYFPFEGGVMSIDPAGRGADRTAYAIVK
E3SME4_9CAUD          CSSKDN---ILKDLPCVGLPGDYYYSPMQVQGEWKPYSETICSVDPSGRGSDETVACFIS
M4NK29_9CAUD          CSDPKN---VIKDAPTVGLPGDYFYSPMQLQGEWYPYQETICSVDPSGRGSDETAAAFIS
A0A516MQ45_9VIRU      SKNPLV---KLKDLPNVATAGQDYYSHEKLSDGFSEPMMRTLAIDPSGRGKDETAYAVGF
A0A1W6JS52_9CAUD      MPNAAN---ECKGVPVVGLKGDRFHRYESVGQATASYAQKILVIDPSGRGKDETGYAVLY
A0A516LVT9_9VIRU      AQTPEL---EWDRLPNVGLRGDRFYRPMKILGDMIPYTGSVMSIDPSGRGRDETGYAVVK
A0A516LLN2_9VIRU      CNDPDK---VINDLPCVGFNGDRYFRPMATDGDLVDYETKVLAVDPSGAGTDETAIAVTA
A0A060BK33_9CAUD      GSSRE----LLVDLPNIGFTGDSLYRASHIDKDYAPYEYSVLSIDPSGRGKDETGYAVIK
A0A516LV17_9VIRU      AASPDL---VDSDLPNVGFNGDRYYRPMVTQGEWLPYSGSVMAIDPSGRGQDETAFAVVK
A0A516M395_9VIRU      CRSPDK---RLKDPPCAGMNGDHWYAPLERIGDMVEYSGIAMAVDPSGRGRDETSWAIAA
M4NUY4_9CAUD          CSDPQN---VIKDLPIVGLPGDYFYSPMQLQGDWDPYQETICSIDPSGRGTDETTAAYLS
                                       .  *:                     :**:* * *        

TERL_BPT3             TLNGYIYLMEAGGFPDGYSDKTLESLAKKANEWKVQTVVFESNFGDGMFGKVFSPVLLKH
TERL_BPT7             TLNGYIYLMEAGGFRDGYSDKTLELLAKKAKQWGVQTVVYESNFGDGMFGKVFSPILLKH
M1PW71_9CAUD          QANGYIFVRDMKAFRDGYSDDTLREIVSLAKRYRASTLLVESNFGDGMVCELIKRHLIQQ
I6Q9Q6_9CAUD          TLNGYIYLMEAGGFRDGYSDKTLELLAKKAKQWGVQTVVYESNFGDGMFGKVFSPILLKH
A0A219YHD1_9CAUD      TLNGYIYLMDAGGTR-GYEEKSLEFLAKKAKQWQVQTVVFESNFGDGMFGNVFQPVLLKH
A0A1T5BR17_9SPHN      FLNGHVYVRKWGGYVDGHSDATLRALAEIAKEEEVNLIRVEANFGDGMFSRLLEPHLRKI
A0A3A6W2V7_9FIRM      YLNGYLFVLEVGGTREGYNDSTLRQLANKAKIYGVNEIVVEGNFGDGMFSQLFKPVLNDI
M1IPT5_9CAUD          MLHGVLYLTSVGSLEGGYSETTMARLSNIAKKHDVNYVVIESNFGDGMATQLLKPVMAKI
D1L2X6_9CAUD          TLNGYIYLMDAGGTR-GYEEKSLEFLAKKAKQWQVQTVVFESNFGDGMFGNVFQPVLLKH
M1PKP4_9VIRU          YLNGNLFLLASGGLRGGYSEVNLKKLSLIAKEYKVKQILVESNLGLGMFSELLKRYLGTI
A0A1Y0SYB4_9CAUD      SLNGYIFLMDNGGCKDGYSDVTLEFLAKKAKQWKVDTAIFESNFGDGMFGKVFSPVLLKH
A0A140XFQ2_9CAUD      TLNGYIYLMEVGGFRGGYDDPTLEKLAKKAKQWKVQTVVHESNFGDGMFGKVFSPVLLKH
A0A2D2W5F3_9CAUD      ILAGNLFLVAAGGLSGGYSDETLETLARLAKTHQVNHVIIEANFGDGMYTKLITPFFGKV
A0A0E3JQM8_9CAUD      TLNGYIYLMEAGGFRDGYSDKTLESLAKKAKQWKVQTVVFESNFGDGMFGKVFSPVLLKH
A0A1B2ANE0_9CAUD      QLNGYIFLMEWGGFRGGYEDSTLMALAQIGKKHKVNEVVIEGNFGDGMYTKLFSPVMTRV
A0A4Y1NTW0_9CAUD      MLNGILYLTDIGSLEGGYEEKTLVDLANAAKAQNVSYITIESNFGDGMFNRLLEPILARI
E3SME4_9CAUD          QLNGIMYLHEVYASTDGYSDKTLLSILARCKKYKVSTLLIESNFGDGMVSELFRKHAINK
M4NK29_9CAUD          QRNGYLYLHEMRAYRDGYSDNTLLDILRGCKKFNVTKLVIETNFGDGIVAELFKKHLQQT
A0A516MQ45_9VIRU      MLHGNIFVPDAGGIVGGYSDDAMIQLAEIAKKYKVNKIIIESNFGDGMFSQLLKPHLTRI
A0A1W6JS52_9CAUD      QLNGYIFLMDAGGFRGGYEDTVLQALANIAKIHKVNEIVVEGNFGDGMYIKLLAPVVTAT
A0A516LVT9_9VIRU      MCNGTLYVPEAGGLRGGYEEPTLLELVRIAKRNKVNAVITESNFGDGMFNQLITPIFSRE
A0A516LLN2_9VIRU      SYAGQAFVLECRGIKGGFGEPVLAEIAQIAKKHKVNLILVESNLGQGMFSSLLKPHLAKV
A0A060BK33_9CAUD      QLHSKVFVADVGGISGGYTPENLVKIAQLAKEHMCNVIIIESNFGDGMFNELLKPILKSI
A0A516LV17_9VIRU      MLHSQLFILEAGGLQGGYEEETLKALSALAKKQDVNKVIIESNFGDGMYTSLLRPVMAKI
A0A516M395_9VIRU      TYAGQIFLLDAGGMQGGYGEEVLDRLAYLAKRYKVRQIIIEENFGQGMFESLLKPVLNRV
M4NUY4_9CAUD          QRNGFLYLHEMRAYRDGYSDQTLLDILKGCKKYEVSKLVIETNFGDGIVSELFRKHLQQT
                         .  ::    .   *.    :  :    :         * *:* *:   ::       

TERL_BPT3             -HAAALEEIRARGMKELRICDTLEPVLSTHRLVIRDEVIREDY---QTA-RDADGKHDVR
TERL_BPT7             -HNCAMEEIRARGMKEMRICDTLEPVMQTHRLVIRDEVIRADY---QSA-RDVDGKHDVK
M1PW71_9CAUD          QCSAHVEEVRASVRKEERIIATLEPVLNQHKLVMDPKIIEWDY---RSN-PDSPPEKRLE
I6Q9Q6_9CAUD          -HNCAMEEIRARGMKEMRICDTLEPVMQTHRLVIRDEVIRADY---QSA-RDVDGKHDVK
A0A219YHD1_9CAUD      -HPAQLEEIRARGMKEVRICDTLEPVLASHRLVIRDEVIRQDY---QTA-RDADGKHALK
A0A1T5BR17_9SPHN      GYIVPIEDHKVHGKKEERIIATVRPALQAHRIVMDTSLVRQDLEEARSGSHEGQGVSKAE
A0A3A6W2V7_9FIRM      -HPCSVTEVKNYAQKEARIIDTLEPVMMRHKLIIHKQVILDDY---QVY-ENAPA-----
M1IPT5_9CAUD          -HPCEIEEVRHNTQKEKRIIDTLEPLMNSHRLVVDDLLIHEDF---KNE-PD--------
D1L2X6_9CAUD          -HPAQLEEIRARGMKEARICDTLEPVLASHRLIIRDEVIRQDY---QTA-RDADGKHALK
M1PKP4_9VIRU          -YPCSIEEVRHTKQKETRIIDTLEPVMNQHRLMVDTDIIAKDI---AST-QCYPTETRSQ
A0A1Y0SYB4_9CAUD      -HRCVLEEIRAKGQKEVRIIDTLEPVLSTHRLVVSKDCIDTDY---KTA-VNNDGKHEVK
A0A140XFQ2_9CAUD      -HKCALEEIRARGMKEMRICDTIEPLMGAHRLIIRDEVIREDY---QTA-RDLDGKHDVR
A0A2D2W5F3_9CAUD      GHKVLVEEVKHSTQKEARIIDTLEPVLSTHRLIVDQKVIENDF---RTA------ERDIK
A0A0E3JQM8_9CAUD      -HAAAMEEIRARGMKELRICDTLEPVLSTHRLVIRDEVIREDY---QTA-RDADGKHDVR
A0A1B2ANE0_9CAUD      -HRCAITEVKSKGQKEMRICDVLEPVLGSHKLIVHESVIEADY---RTA-LNADGTTDVA
A0A4Y1NTW0_9CAUD      -HPCTIEETRSSVQKEKRIIDTLEPVFNSHRLVVDQELIRKDY------------ELDMH
E3SME4_9CAUD          NVPINIEETRANVRKEDRIIDSLEPVFNQHRLVVDPRVIKWDF---DSG-SERPSESRFQ
M4NK29_9CAUD          KQAIGVEEVRATLRKEQRIIDALEPILNQHRLIVDRSVIDWDY---TSN-KDEAPEKRLQ
A0A516MQ45_9VIRU      -YPCSVDEVRQNIQKELRIIDTLEPVMNQHRLIIDPQVIQKDY---DTAMERYTSDTATK
A0A1W6JS52_9CAUD      -FPCAITEVKSKGQKELRICDVLEPVLGSHKLVIQEGLIEKDY---RTA-LNADGTTDTS
A0A516LVT9_9VIRU      -YPVTLEEVRHHQQKEKRIIDTLEPLLAAHRLVIAPSVIENDY---KTA-QGYPPEQQLR
A0A516LLN2_9VIRU      -YPCGIEDVRHHIQKEKRICDTIEPLAGSRRLLIDRSVIQRDY---DSV-QDLPADKARQ
A0A060BK33_9CAUD      -YPCSVEEVRNNKQKELRIIDTIEPLLNQHRLVFDYSLLKRDI---NGA---VSDHKNLS
A0A516LV17_9VIRU      -HPVEIEEVRHSIQKERRIIDTIEPVLSSHRLVVDRRLIEQDF---QST-QHLPPEKALK
A0A516M395_9VIRU      -YPCAIETVRHHTQKERRICDVLEPLMNSHKLVVDQNVLVKDW---ESV-KDYAPEEQRN
M4NUY4_9CAUD          NQRIDVEEVRATVRKEDRIIDSLEPVLNQHRLIIDRSVIEWDF---KSN-PDEAPEKRLM
                           :   .    ** **   : *    ..::.    :  *                  

TERL_BPT3             YSLFYQLTRMAREKGAVAHDDRLDAFRLGVEFLRSTMELDAVKVEAEVLEAFLEEHMEHP
TERL_BPT7             YSLFYQMTRITREKGALAHDDRLDALALGIEYLRESMQLDSVKVEGEVLADFLEEHMMRP
M1PW71_9CAUD          YMLMYQCSRMCKEKGAVKHDDRIDAMAQGVQWFTDALALSAQKQQAQRRNDEWSAMQQMI
I6Q9Q6_9CAUD          YSLFYQMTRITREKGALAHDDRLDALALGIEYLRESMQLDSVKVEGEVLADFLEEHMMRP
A0A219YHD1_9CAUD      YSLFYQMTRMSREKGAVAHDDRLDALALGVEFLRSTMQQDAVKIEAEVLQEFLEHHMEKP
A0A1T5BR17_9SPHN      RSGLYQLTHMSAAKGALRKDDRIDVLSNALAYWAEYMGADAEEAER-RAEAKATAEFEKA
A0A3A6W2V7_9FIRM      YSLIYQMTRLSRDRGALAHDDRLDALCMAVAYWLAVMDRDEEIGMQ----EQIEAKLEQW
M1IPT5_9CAUD          HQLFRQMTRLTRDKGSLRHDDAIDALAMAAKYWVDRIDRDQTLSYNQHKEELLDQELERF
D1L2X6_9CAUD          YSLFYQMTRMSREKGAVAHDDRLDALALGVEFLRSTMQQDAVKIEAEVLQEFLEHHMEKP
M1PKP4_9VIRU          YQLFWQMTRITKEKNSIRHDDRLDALAMAVQFFTENMALTEQKAIKTREREQWELE-RQF
A0A1Y0SYB4_9CAUD      YSLFYQLSRITKDRGALAKDDRLDSLALGVEYLKELVKLNADKQQEELIEEFLESHMSNP
A0A140XFQ2_9CAUD      YSAFYQMTRMTREKGAVAHDDRLDAIALGIEFLREGMQVDSKVGEEAMTLEFLEHHMEKP
A0A2D2W5F3_9CAUD      YSLFYQMTRITRDKGALAHDDRLDALAIAVAYWTEHMSRDNDKAAAAIKDKALKDELKKF
A0A0E3JQM8_9CAUD      YSLFYQLTRMAREKGAVAHDDRLDALALGVEFLRSTMELDAVKVEAEVLEAFLEEHMEHP
A0A1B2ANE0_9CAUD      YSGFHQLTRLTKERGSLGHDDRLDALAIGVQFFTDSMEKDSEKGAEEMLEGFLEDHLENH
A0A4Y1NTW0_9CAUD      HQLFYQMTRLTKDRSCLKHDDLIDVLAMAVGYWTNYIGRDVFEAEQEARNERLSIELDKF
E3SME4_9CAUD          YMLGYQISRMCREKGAVKHDDRIDALAQGVKWFTDALAISASAAIKDRKDQEWLDHLEAW
M4NK29_9CAUD          YMLFYQMSRMCMEKGAVRHDDRIDCLAQGVKYFTDAMGISAQEAVNQRKRDEWNDLLRST
A0A516MQ45_9VIRU      YMLFYQMTRLSKERGSLAHDDRLDALAMMVQYFLEQLSVDQHMQEQQRREEAFDAQLDKF
A0A1W6JS52_9CAUD      YSLLYQLTRITRERGSLAHDDRLDALAIGVQFFTEALERDSKVGESEMLQEFLESHMEDA
A0A516LVT9_9VIRU      YMMMYQLTRLTRLRGALRNDDRLDALSIACNYWVEQMAQDADMKIKERREDLASKELDKF
A0A516LLN2_9VIRU      YQLMYQFSRITRDRGALRHDDRLDALSMALGFHADAMARDRDREMHEIREDKHNKMLEAY
A0A060BK33_9CAUD      YSLVHQLTHISKDRGSLYHDDRLDALSIALGYIVNNLGLSSEEALERYKEDLLEQELEDF
A0A516LV17_9VIRU      YQLFYQLSRITRQKGALVHDDRLDVLSMAVGYWAEQMAADRDRLMKEAHNTKLRDELENF
A0A516M395_9VIRU      YLLAYQMSRITREKGSLRQDDRLDALAMVCQYWVDAASRDVDRVASMRRDDLQQKAIEAF
M4NUY4_9CAUD          YMLFYQMSRMCREKGAVKHDDRIDCLAQGVQYFTDALGISAQEAIKERKRLEWNAMIEEM
                           * :.:   ...: :** :* :     :                            

TERL_BPT3             IHS----AGHVVTAMVDGMELYWEDDDVNGDRFINW-------------
TERL_BPT7             TVA----ATHIIEMSVGGVDVYSEDDEGYGTSFIEW-------------
M1PW71_9CAUD          LEDPQRATDALALGL-----GFKELSERRTNRVYDWV------------
I6Q9Q6_9CAUD          TVA----ATHIIEMSVGGVDVYSEDDEGYGTSFIEW-------------
A0A219YHD1_9CAUD      LSN---ISQFRVTSSN-GVDIRWEDD-GDDSMFIAW-------------
A0A1T5BR17_9SPHN      LFG---------SAILPIHTRPTHRARGRGRRR----------------
A0A3A6W2V7_9FIRM      LNP------DKGIFYRDETNQMRPMGRSEAKRISTYNMLKNY-------
M1IPT5_9CAUD          MEN----------------------NIGRTQTKDRWI------------
D1L2X6_9CAUD          LSN---ISQFRATSSN-GVDIRWEDD-GDDSMFIAW-------------
M1PKP4_9VIRU          IQG-EGGLNVGVLGYAKSLEDLQKASLGASGGA-NWLDGY---------
A0A1Y0SYB4_9CAUD      ISS----NESISTTLSGGVTFIWNEEQDEFGMI-NYLN-----------
A0A140XFQ2_9CAUD      IIG-----GDMARELVSGGVDIYYEDDGDSSSFIEW-------------
A0A2D2W5F3_9CAUD      VHG----------------------VLGSKPKRTSWMSSNSGSR-----
A0A0E3JQM8_9CAUD      IHS----AGHVVTSMVDGMELYWEDDDVNSNRFIDW-------------
A0A1B2ANE0_9CAUD      LVG---YEHAREIALGDGVSITWDDDDGTEG---SWI------------
A0A4Y1NTW0_9CAUD      MET----------------------AIGQSTSNKSWL------------
E3SME4_9CAUD          MDDPQAEANHLVLGMN-HMQRKEARGKTKGKPLPTWV------------
M4NK29_9CAUD          IDDPQSSANHLVLGMN--MEQRQAARGNAKNGVPTWV------------
A0A516MQ45_9VIRU      IED------WYDMGYRSNNQGLRIRNMGRKHQ-----------------
A0A1W6JS52_9CAUD      LMG----HDRLLEMSISEGVSIQYEDDGSMSNYMGWR------------
A0A516LVT9_9VIRU      MDT--------------------YYKRTKRPQS-SWI------------
A0A516LLN2_9VIRU      MES-----------------GPSSVTIGAKPTSMTWLS-----------
A0A060BK33_9CAUD      LRP----------------ISLWNNNKTDHSKHNNYLDSLSIN------
A0A516LV17_9VIRU      MTH----------------------ALGRPKRGNTWMQT----------
A0A516M395_9VIRU      LEN--------------------AIGGPPAPKTPTWTESRPGLTPPTMF
M4NUY4_9CAUD          IDDPQASANHMVLGMN--LEQRQQAKGNSKTSVPHWV------------