CLUSTAL format seed alignment for MF_04148

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TERL_BPP22            MELDAIL------DNLSDEEQIELLELLEEEENYRNTHLLYEF--APYSKQREFIDAGHD
TERL_BPLP7            MELDAIL------DNLSDEEQIELLELLEEEENYRNTHLLYEF--TPYSKQREFIDAGHD
A0A3G8FE42_9CAUD      ---------------MDREQKIELLRLLEEKSRRANVYRYKTYYETRYPWQKKFIALSIE
A0A2Z3DM37_9CAUD      MSLDKEIYEALTGDKLTVEEKKRLLGILKERDTWRKYNKILAF--KAYDFQKKFYEAGLK
Q5C836_9VIRU          MELDAIL------DNLSDEEQIELLELLEEEENYRNTHLLYEF--TPYSKQREFIDAGHD
A0A386K5T1_9CAUD      -----------------MDTQERLRNLVRELAERQKYFRMNQY--TPYGWQEKFIAASSN
Q2A0C1_9CAUD          ------M------DHLNRKQKIQQVRFINEQRRREHACRYRHYYGTRYDWQRKFIGLSAE
I2FLT9_9CAUD          -----------------MNQTERALALLKELQDRQKYWKIKQY--TPYGWQEKFINASSN
A0A0N7CAS4_BPP22      MELDAIL------DNLSDEEQIELLELLEEEENYRNTHLLYEF--APYSKQREFIDAGHD
A0A2Z5HR63_9CAUD      MELDAIL------DNLSDEEQIELLELLEEEENYRNTHLLYEF--TPYSKQREFIDAGHD
C6ZR07_9CAUD          MELDAIL------DNLSDEEQIELLELLEEEENYRNTHLLYEF--APYSKQREFIDAGHD
A0A516L5L0_9VIRU      -----------------MNDIERAVEIARELQYRKDTNRMAFY--EPYEYQKKFHNT--K
                                        .       :  *            :    *  * :*     .

TERL_BPP22            YPERCFMAGNQLGKSFTGAAEVAFHLTGRYPGTKGYPADGKYGGEWKGKRFYEPVVFWIG
TERL_BPLP7            YQSDVLWLVTSLVSHLLALLKSRFTLPGDTRERKVIRLMVNMAESGKVSVSMSQLSSGIG
A0A3G8FE42_9CAUD      YSQVALIAANRVGKTDTATYIDAIHAMGDYPD------------DWEGYKFEHAPLIWCL
A0A2Z3DM37_9CAUD      HRFRFLCAANRVGKSYSEAYEFACHVTGRYPT------------WWTGYKFKRPILAWAV
Q5C836_9VIRU          YPERCFMAGNQLGKSFTGAAEVAFHLTGRYPGTKGYPADGKYGGEWKGKRFYEPVVFWVG
A0A386K5T1_9CAUD      CAQLLAMTGNRCGKTYTGAFIMACHLTGRYPE------------WWTGRKYDRPVNCWAA
Q2A0C1_9CAUD          YAQVALIAANRVGKTDTATYVDAVHALGDYPE------------AWSGYRFSHAPVIWCL
I2FLT9_9CAUD          AAQLLAMTGNRCGKTYTGAFIMACHLTGLYPD------------WWEGRRYNKPIEAWAA
A0A0N7CAS4_BPP22      YPERCFMAGNQLGKSFTGAAEVAFHLTGRYPGTKGYSADGKYGGEWKGKRFYEPVVFWIG
A0A2Z5HR63_9CAUD      YPERCFMAGNQLGKSFTGAAEVAFHLTGRYPGTKGYPADGKYGGEWKGKRFYEPVVFWVG
C6ZR07_9CAUD          YPERCFMAGNQLGKSFTGAAEVAFHLTGRYPGTKGYPADGKYGGEWKGKRFYEPVVFWIG
A0A516L5L0_9VIRU      AQQRLLMAGNRIGKSFCGAMEMAFHLTGQYPD------------WWNGRRFNRPIRAWAG
                               .   .             *                                

TERL_BPP22            GETNETVTKTTQRILCGRI--EENDEPGYGSIPKEDI-ISWKKSPFFPNLVDHLLVKHHT
TERL_BPLP7            GETNETVTKTTQRILCGRI--EENDEPGYGS-PKED--SSWEKSSVLLILLIIFSLSHHR
A0A3G8FE42_9CAUD      GYSGEKCRDLLQAPIIGRK--TDNGWQG-GLIPSELI-VDTEPMAGTPNAVRSAYIRHKS
A0A2Z3DM37_9CAUD      GITGDSTRKVLQKELFGTPIGKDTDLIGTGVIPRDAIVIDTIERDG--NKLQIVQIKHQN
Q5C836_9VIRU          GETNETVTKTTQRILCGRI--EENDEPGYGSIPKEDI-ISWKKSPFFPNLVDHLLVKHHT
A0A386K5T1_9CAUD      GISTDTTRDILQSELLGDW--KNPEAFGTGMIPKEDI-VETIRREGKPGCVQAVVVKHAS
Q2A0C1_9CAUD          GYSGEKCRDLLQTPLLGRK--TDNGWQG-GLIPGERI-ADTEAMTGTTNAVRTAYIRHVS
I2FLT9_9CAUD          GISTDTTRDILQSELLGKW--SDPSRFGTGAIPKEMI-LETVRREGKPGCVQTVLVKHVS
A0A0N7CAS4_BPP22      GETNETVTKTTQRILCGRI--EENDEPGYGSIPKEDI-ISWKKSPFFPNLVDHLLVKHHT
A0A2Z5HR63_9CAUD      GETNETVTKTTQRILCGRI--EENDEPGYGSIPKEDI-ISWKKSPFFPNLVDHLLVKHHT
C6ZR07_9CAUD          GETNETVTKTTQRILCGRI--EENDEPGYGSIPKEDI-ISWKKSPFFPNLVDHLLVKHHT
A0A516L5L0_9VIRU      GASNETTRDICQKELVGQP--DDPSAKGTGSIPLKYI-GETVRKAGVPNAMNSLVIKHVT
                      * : :.  .  *  : *     :    * *  * .    .          :    : *  

TERL_BPP22            ADGVEDGISICYFKPYSQGRARWQGDTIHGVWFDEEPPYS---IYGEGLTRTNK----YG
TERL_BPLP7            LM-VLKMHSICYFK-HTRRHRHAAGDTITAYGLTKRLPYS---IYAEGLTRTNK----YG
A0A3G8FE42_9CAUD      -----GDLAKIQFWSYSQGQHALMGDSVDWFHIDEEPKDPT--IYPQVLTRTATGDKGRG
A0A2Z3DM37_9CAUD      ERGEFDGLSTLEFRSTQQGEHTLMGATVDYIWLDEEDPYESMAIFSQCVTRTLT----TK
Q5C836_9VIRU          PEGVEDGISICYFKPYSQGRARWQGDTIHGVWFDEEPPYS---IYGEGLTRTNK----YG
A0A386K5T1_9CAUD      -----GGLSSLIFKSYEMSQDKFMGTAIDVIWLDEECPKD---IYTQCVTRTAT----TG
Q2A0C1_9CAUD          -----GLLSKIQFWSYSQGQHALMGDCVDWFHIDEEPRDPT--IYPQVLTRTATGDRGKG
I2FLT9_9CAUD          -----GGTSILTFKSYEMSQDKFMGTAIDVIWLDEECPKD---IYTQCVTRTAT----TG
A0A0N7CAS4_BPP22      ADGVEDGISICYFKPYSQGRARWQGDTIHGVWFDEEPPYS---IYGEGLTRTNK----YG
A0A2Z5HR63_9CAUD      PEGVEDGISICYFKPYSQGRARWQGDTIHGVWFDEEPPYS---IYGEGLTRTNK----YG
C6ZR07_9CAUD          PEGVEDGISICYFKPYSQGRARWQGDTIHGVWFDEEPPYS---IYGEGLTRTNK----YG
A0A516L5L0_9VIRU      -----GGWSRLAFKAYEMGKEKWMGESLDVIWLDEEPPSS---IYTQSLTRTAD----KG
                              :   *.          *  :    : :        *: : :***        

TERL_BPP22            QFSILTFTPLMGMSDVVTKFLKNPSKSQK----VVNMTIYDAE-----HYTDEQKEQIIA
TERL_BPLP7            QFSILTFTPLMGMSDGVTKFLKNPSKSQK----VVNMTIYDAE-----HYTDEQKEQIIA
A0A3G8FE42_9CAUD      GRGILTFTPENGRTDLVISFMDSPSSAQT----CMNVGWDDAP-----HLSEKVKEDLLA
A0A2Z3DM37_9CAUD      GLVTITATPENGLTELVDKFMKGEGDADTGSLYFQNASWWDAHVDLGGHISDKDIKDMTE
Q5C836_9VIRU          QFSILTFTPLMGMSDVVTKFLKNPSKSQK----VVNMTIYDAE-----HYTDEQKEQIIA
A0A386K5T1_9CAUD      GIVYLTFTPEHGLTEIVKDFLQDLKPGQF----LVHASWEDAP-----HLSPEVKEQLLS
Q2A0C1_9CAUD          GRGILTFTPENGRTDLVIGFMDNPSPAQT----CINVGWDDAP-----HLSQKVKNDLLA
I2FLT9_9CAUD          GIVYLTFTPEHGATELVKEFMQDLKPGQF----MIGATWDDAP-----HLSEEVKEQLLS
A0A0N7CAS4_BPP22      QFSILTFTPLMGMSDVVTKFLKNPSKSQK----VVNMTIYDAE-----HYTDEQKEQIIA
A0A2Z5HR63_9CAUD      QFSILTFTPLMGMSDVVTKFLKNPSKSQK----VVNMTIYDAE-----HYTDEQKEQIIA
C6ZR07_9CAUD          QFSILTFTPLMGMSDVVTKFLKNPSKSQK----VVNMTIYDAE-----HYTDEQKEQIIA
A0A516L5L0_9VIRU      GIVYMTFTPENGMTETVAQFVNDLRDGQA----LIQAGWDDAP-----HMTDTVRDQILA
                          :* **  * :: *  *:..   .:            **      * :    .::  

TERL_BPP22            SYPEHEREARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIDAQDFGWNHPQAHIQL
TERL_BPLP7            SYPEHEREARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIDAQDFGWNHPQAHIQL
A0A3G8FE42_9CAUD      SFPPHQRDMRTKGIPMLGHGRIYDFGEEFITCDPFPVPDHWAVIDGMDFGWDHPQAHIQL
A0A2Z3DM37_9CAUD      GIPAWQLEMRSKGMPLLGSGLIYDVSDDSVKCEPFDIPDTWKRVCAVDIGIDHPTAAVWS
Q5C836_9VIRU          SYPEHEREARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIDAQDFGWNHPQAHIQL
A0A386K5T1_9CAUD      VYSPAERRMRAEGVPMLGSGVVFPILEEKFVCEPFQIPDHFHRIIGIDLGFDHPNAIACV
Q2A0C1_9CAUD          SFPAHQRDMRTKGIPMLGHGRIYDLGEDFITCDPFPVPAHWLVIDGMDFGWDHPQAHIQL
I2FLT9_9CAUD          VYSPAERAMRASGKPMLGSGVVFVVPEERIVVQPIAIPNHWHHIIGIDLGFDHPNAIACL
A0A0N7CAS4_BPP22      SYPEHEREARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIDAQDFGWNHPQAHIQL
A0A2Z5HR63_9CAUD      SYPEHEREARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIDAQDFGWNHPQAHIQL
C6ZR07_9CAUD          SYPEHEREARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIDAQDFGWNHPQAHIQL
A0A516L5L0_9VIRU      ALPPHERKMREQGIPQLGSGLVFPLPESQMVCDPIEIPTYWPRICGIDFGWDHPTAAAWV
                        .  :   *  * * :* * :: . :. .  :*:  *  :  : . *:* :** *    

TERL_BPP22            WWDKDADVFYLARVWKKSENTAVQAWGAVKSW-ANKIPVAWPHDGHQHEKG-GGEQLKTQ
TERL_BPLP7            WWDKDADVFYLARVWKKSENTAVQAWGAVKSW-ANKIPVAWPHDGHQHEKG-GGEQLKTQ
A0A3G8FE42_9CAUD      AIDLDNDAYYVTRAWKASKTSPAEAWGAVNKW-AKDIPTAWPQDGLQTEKG-SGLQQKEY
A0A2Z3DM37_9CAUD      AYDANTDTIYIYDCYREGGYTPAYHAPAINGR-GQWIPVVLPHDADNLEKG-SGSSVAQF
Q5C836_9VIRU          WWDKDADVFYLARVWKKSENTAVQAWGAVKSW-ANKIPVAWPHDGHQHEKG-GGEQLKTQ
A0A386K5T1_9CAUD      AWDPEKDKYYLYDERSESGETLGMHADAIYLKGGHQIPVVVPHDAFKHDGATSGRRFVDL
Q2A0C1_9CAUD          VWDNENEMFYVTRAYKARQVSPAEAYSAVSIW-AENVPTAWPSDGLMTEKG-SGIQQKTY
I2FLT9_9CAUD          ALDPTTGTYYLYDERSERGETLSMFAQAIRAKGGDTIPVVVPHDAFKHDGATSGRRFVDL
A0A0N7CAS4_BPP22      WWDKDADVFYLARVWKKSENTAVQAWGAVKSW-ANKIPVAWPHDGHQHEKG-GGEQLKPN
A0A2Z5HR63_9CAUD      WWDKDADVFYLARVWKKSENTAVQAWGAVKSW-ANKIPVAWPHDGHQHEKG-GGEQLKTQ
C6ZR07_9CAUD          WWDKDADVFYLARVWKKSENTAVQAWGAVKSW-ANKIPVAWPHDGHQHEKG-GGEQLKTQ
A0A516L5L0_9VIRU      AWDRDSDIIYIYDTYAMSQEAVPIHASAIKSK-GNWIPVIWPMDGRQADKG-SGKSLTEQ
                        *      *:         :      *:  . .  :*.  * *.   : . .*      

TERL_BPP22            YADA-GFSMLPDHATFPD--------GGNS--VESGISELRDLMLEGRFKVFNT--CEPF
TERL_BPLP7            YADA-GFSMLPDHATFPD--------GGNS--VESGISELRDLMLEGRFKVFNT--CEPF
A0A3G8FE42_9CAUD      YEDA-GFKMLNDPAQWPD--------KSRS--VEAGLFEIYDLMRTGRFKVFRG--LRDW
A0A2Z3DM37_9CAUD      YRNA-GVNVQSETFYNKI-----GMDGKKNFFVEPGITDIRERMMSGRFKIFNTASCAKL
Q5C836_9VIRU          YADA-GFSMLPEHATFPD--------GGNS--VESGIGELRDLMLEGRFKVFNT--CEPF
A0A386K5T1_9CAUD      LKDDHNLNVVYEPFSNPP--GPDGKHGGNS--VEFGVNWMLTRMENGDLKVFNT--CTNF
Q2A0C1_9CAUD          YDDA-GFCMLRDPAQWPD--------GSRS--VE-----LHDLMRRGKFKVFSG--LRDF
I2FLT9_9CAUD          LRDDHKLNIVYQPFSNPP--GPDGKPGGNS--VEFGVNWMHTHMDNGKFKVFST--CTKF
A0A0N7CAS4_BPP22      MR------------------------------------------MPGSL-------CFPI
A0A2Z5HR63_9CAUD      YADA-GFSMLPDHATFPD--------GGNS--VESGISELRDLMLEGRFKAFNT--CEPF
C6ZR07_9CAUD          YADA-GFSMLPEHATFPD--------GGNS--VESGISELRDLMLEGRFKVFNT--CEPF
A0A516L5L0_9VIRU      YRSE-GVNMTREHFSNPPQQGQKEGSGGNS--VEAGVQEIYTRLMTNRLKIFNN--QSKL
                                                                    . :           

TERL_BPP22            FEEFRLYHRDENGKIVKTNDDVLDATRYGYMMRRFARMMRDIRKPK-EKKIPAPIRPVRR
TERL_BPLP7            FEEFRLYHRDENGKIVKTNDDVLDATRYGYMMRLRQDDARY-------------------
A0A3G8FE42_9CAUD      FEEYNFYHRDEKGKIVKTRDDLLDATRYAYMMRRFAKRFGEVGKVK-QRVIPAPIRPIRR
A0A2Z3DM37_9CAUD      FEEKARYHRKV-GRIVKEHDDLMDAMRYSACSVTHRGRSKHDASYG-SSSLYQENINRWN
Q5C836_9VIRU          FEEFRLYHRDENGKIVKTNDDVLDATRYGYMMRRFARMMRDIRKPK-EKKIPAPIRPVRR
A0A386K5T1_9CAUD      LKEMKMYHRKD-GKIIDRNDDMISATRYALLMASRHARPGAVRNSGYYRSDTAKLTPDWF
Q2A0C1_9CAUD          FDEYNFYHRDEKSRIVKMRDDILDAVRYAYMMRRYAVRYADVKNPPVERDVYVPSSSSW-
I2FLT9_9CAUD          LQEMKLYHRKD-GKIIDRSDDMISATRYAALMMGRHGVPGGASN---NYTWSGPLRPAWF
A0A0N7CAS4_BPP22      TQRSRMAVTQ--------------------------------------------------
A0A2Z5HR63_9CAUD      FEEFRLYHRDENGKIVKTNDDVLDATRYGYMMRRFARMMRDIRKPK-EKKIPAPIRPVRR
C6ZR07_9CAUD          FEEFRLYHRDENGKIVKTNDDVLDATRYGYMMRRFARMMRDIRKPK-EKKIPAPIRPVRR
A0A516L5L0_9VIRU      LEELRMYHRKD-GKIVTKHDDVISAMRYAVMSVRKARIK--------DYEPIQLESDSSF
                       .       .                                                  

TERL_BPP22            GR--
TERL_BPLP7            ----
A0A3G8FE42_9CAUD      ----
A0A2Z3DM37_9CAUD      SSY-
Q5C836_9VIRU          GR--
A0A386K5T1_9CAUD      GSIV
Q2A0C1_9CAUD          ----
I2FLT9_9CAUD          DGVR
A0A0N7CAS4_BPP22      ----
A0A2Z5HR63_9CAUD      GR--
C6ZR07_9CAUD          GR--
A0A516L5L0_9VIRU      NVFM