CLUSTAL format seed alignment for MF_04153

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A0A7D5FW54_9CAUD      MAKE--QLKTFTTPVAGIVEPYAWLNRADTKFN------ERGEHKVNLTFNLSDPKVRKM
W6PNB4_9CAUD          MAKTFTKPKVFTTPVVGTLEPYAWLNKADTKYN------ERGVHSCKLTFDLSEPRVQKM
A0A2D0YYU6_9CAUD      MAND----KKFYRTPIGVVGVYPYIQRPDTQFN------DRGEYRIKLAVPSDK--AQKL
SSB_BPT7              ---M---AKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRM
SSB_BPT3              MAGF---KKKVYTSGLGTAEPYAYLSKPDYGNEERGFGNPRGVYKVDLTLSNKDPRCQAM
Q858M5_9CAUD          ---M---AKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRM
A0A1I9SE95_9CAUD      MAKE--QLKTFTTPVAGIVEPYAWLNKADTKFN------ERGEHKVNLTFDLSNPKVRKM
A0A1L7DS03_9CAUD      MAFN---LKKVYTSGLGTADGYVYLNKPDYGNEEKGFGNPRGVYKVDLTLDNASPACKRM
Q4TVX4_9CAUD          MAND----KKFYRTPIGVVGAYPYIQRPDTQFN------DRGEYRIKLAVPSEK--AQKL
A0A5J6T7Y1_9CAUD      ---M---AKKIFTSALGTAEPYAYISKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRM
A0A3S9U7Z0_9CAUD      MAFA---KKKIYTTKIGTCEPYAYFNKPDYGGE--GFENPRGTYKGSVTFKNED--CQEL
A0A514A6V6_9CAUD      MAFA---KRKVFTSARGIAEPYCYLAKPDFGSG--DFKNERGVYKVSLTVSNDDPRCQKM
A0A481V756_9CAUD      ---M---AKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGIFKVDLTIPNKDPRCQRM
A0A2H1UJ76_9CAUD      MAFV---KRVVLTSSIGKAEPYCYLAKPDYGKD--DFKNERGVYKVSLTCDNDHPRTQKM
A0A1J0MEI0_9CAUD      MAFI---KRKVFTTARGIAEPYCYLAKPDFGSG--DFKNERGVYKVSLTVSNDDPRCQKM
A0A386K673_9CAUD      ---M---AKKIFTSALGTAEPYAYLSKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRM
A0A385IG14_9CAUD      MA-------KTLISPRGVIAPYAYIQRPDTKFN------DRGIYKMTLTCDINDPAVVKL
A0A5Q2WCJ2_9CAUD      MAGF---KKKIYTSGLGTAEPYAYLSKPDYGNEERGFGNPRGIYKVDLTLSNKDPRCQAM
A0A385IF45_9CAUD      MA-------KTLISPRGVIAPYAYIQRPDTKFN------DRGIYKMTLTCDINDPAVIKL
E9KIF0_9CAUD          MATA---KRQVFISAKGKAAPYAAIQKPDFGTT--EFPQPRGEYKVNLIVPLKD--AQAD
A0A2U7N592_9CAUD      MAGF---KKEFFFTPRGVVEPYCALQKPDYGNEEKGFGNPRGVWKVNLTLPSRE--AQPI
A0A6M3TA20_9CAUD      MAFV---KKQFFFTPKGKAEPYCSIQKADYGNPEKGFGNPRGVYKVNLTIPSKD--AQPM
A0A0E3JQA8_9CAUD      MAGF---KKKIYTSGLGTAEPYAYLSKPDYGNEERGFGNPRGIYKVDLTLSNKDPRCQAM
F1D0C0_9CAUD          MAND----KKFYRTPIGVVGAYPYIQRPDTQFN------DRGEYRIKLAVPSDK--AQKL
                                   .  *    *  : :.*           **     :            

A0A7D5FW54_9CAUD      IDVLQKIHDDAYAKALADHE-----KNPPQVQRGKK-PIEPREGDMPWIENGDGTVTLKL
W6PNB4_9CAUD          LDVLQKIHDDAYAEALAEHE-----ANPPKVQRGKK-PIEPREGDMPWVENGDGTVTMTF
A0A2D0YYU6_9CAUD      INLITEAHEKN----LEALK-----KNP-KYK-GKR-IK---EGDMPFFEDDEGNVVFTF
SSB_BPT7              VDEIVKCHEEAYAAAVEEYE-----ANPPAVARGKK-PLKPYEGDMPFFDNGDGTTTFKF
SSB_BPT3              VDEIVKTHEEAYAAAVEEFE-----ANPPQVQRGKK-PLTPYEGDMPFFDNGDGTTTFKF
Q858M5_9CAUD          VDEIVKCHEEAYAAAVEEYE-----ANPPAVARGKK-PLKPYEGDMPFFDNGDGTTTFKF
A0A1I9SE95_9CAUD      IDVLQKIHDDAYAKALADHE-----KNPPQVQRGKK-PIEPREGDMPWIENGDGTVTLKF
A0A1L7DS03_9CAUD      VKEIVDMHNEHYAEKLADYE-----ANPPTVARGKK-PLLPYEGDMPFIDNGDGTTTFKV
Q4TVX4_9CAUD          INLITEAHEKN----LEALK-----KNP-KYK-GKR-IK---EGDMPFFEDDEGNVVFTF
A0A5J6T7Y1_9CAUD      VDEIVKCHEEAYAAAVEEYE-----ANPPAVARGKK-PLKPYEGDMPFFDNGDGTTTFKF
A0A3S9U7Z0_9CAUD      VDLIVKTHEENYAARLEAHE-----ANPPKVQKGKKP-LKPYEGDMPFFDNGDGTTTFNF
A0A514A6V6_9CAUD      IDEIVEAHETDYAARLEEYE-----ANPPKVVKGKKP-LKPYVGDMPFMDNEDGTTTFNF
A0A481V756_9CAUD      VDEIVKCHEEAYAAAVEEYE-----ANPPVVARGKKKPIEPYEGDMPFIDNGDGTTTFKF
A0A2H1UJ76_9CAUD      IDEIVACHEADYEARLAEHE-----ANPPKVVKGKKPPKAPYVGDMPFMDNGDGTTTFTF
A0A1J0MEI0_9CAUD      IDEIVEAHETDYAARLEEYE-----ANPPKAVKGKKP-LKPYVGDMPFMDNEDGTTTFHF
A0A386K673_9CAUD      VDEIVKCHEEAYAAAVEEYE-----ANPPAVARGKK-PLKPYEGDMPFFDNGDGTTTFKF
A0A385IG14_9CAUD      MDDILKCHQENYAKIVEEFA-----ANPPKAKPGKK-VLKPYEGDMPFVDNEDGTVSFNF
A0A5Q2WCJ2_9CAUD      VDEIVKTHEEAYAAAVEEFE-----ANPPQAQRGKK-PLKPYEGDMPFFDNGDGTTTFKF
A0A385IF45_9CAUD      MDDILKCHQENYAKIVEEFA-----ANPPKAKPGKK-VLKPYEGDMPFVDNEDGTVSFNF
E9KIF0_9CAUD          IKRITKIYEESYAEFLAEHE-----ANPPKVAPGKR-PVPVRQGDLPFFEDGNGNVVFKF
A0A2U7N592_9CAUD      IDRIVRCHESNWRQIQKDWANGGEAAAKAKLQRGKT-LLQPYEGQLPFFENDDGTVTFKF
A0A6M3TA20_9CAUD      IDRIVKAHEENFAAIMEAWNNGGEAAARAKLQRGKK-LLEPYEGDLPFFENDDGTVTFKF
A0A0E3JQA8_9CAUD      VDEIVKCHEEAYAAAVEEFE-----ANPPQVQRGKK-PLKPYEGDMPFFDNGDGTTTFKF
F1D0C0_9CAUD          INLITEAHEKN----LEALK-----KNP-KYK-GKR-IK---EGDMPFFEDDEGNVVFTF
                      :. :   ::                        **        *::*:.:: :*.. : .

A0A7D5FW54_9CAUD      KCFASYL--KDGKSEPIVLRFYDTDAKRIR-DVPNIGAGSKLKVKFKVLPFKWNAATGAS
W6PNB4_9CAUD          KSFASFI--KDGEVQDIVLRFYDTDAKLIK-NVPNIGSGSGLKVKFKVLPFKWNAATGAS
A0A2D0YYU6_9CAUD      KMYASFKDKETGEMKDLTLRVYDSQGKRIE-DVPAISGGSEGRVEFSLFAYPPSGAVGAS
SSB_BPT7              KCYASFQDKKTKETKHINLVVVDSKGKKME-DVPIIGGGSKLKVKYSLVPYKWNTAVGAS
SSB_BPT3              KCYASFQDKKTKETKHINLVVVDSKGKKIQ-EVPIIGGGSKLKVKYSLVPYKWNTAVGAS
Q858M5_9CAUD          KCYASFQDKKTKETKHINLVVVDSKGKKME-DVPIIGGGSKLKVKYSLVPYKWNTAVGAS
A0A1I9SE95_9CAUD      KCFASYL--KDGKSEPIVLRFYDTDAKLIR-DVPNIGSGSKLKVKFKVLPFKWNAATGAS
A0A1L7DS03_9CAUD      KCYASFQDKKTKETKHITPTIVDANGKVMK-EPPFIRSGSKLKVKYKLFPYTWNTAVGAS
Q4TVX4_9CAUD          KMYASFKDKETGEMKDLTLRVYDSQGKRIE-DVPAISGGSEGRVEFSLFAYPPSGAVGAS
A0A5J6T7Y1_9CAUD      KCYASFQDKKTKETKHINLVVVDSKGKKIE-DVPIIGGGSKLKVKYSLVPYKWNTAVGAS
A0A3S9U7Z0_9CAUD      KCYGSYEDKKTGETKKIVLGVVDAKGKRIQ-DVPIIGGGSKVKIRFSLVPYGWSAVAGAS
A0A514A6V6_9CAUD      KCYGAFTDKKTGENKPIDLAIVDSKGKRIRGERPAISGGSELKIKYTLFPYGWSAVAGAS
A0A481V756_9CAUD      KCYASFQDKKTKETKHINLVVVDSKGKKME-DVPIIGGGSKLKVKYSLVPYKWNNAVGAS
A0A2H1UJ76_9CAUD      KCYGSYIDKKTQETKLIVPTIVDSRGKVIRGDRPAISGGSTLKIKYTLFPYGWSAIAGAS
A0A1J0MEI0_9CAUD      KCYGSYTDKKTGENKPIDLAIVDSKGKRIRGERPAISGGSELKIKYTLFPYGWSAVAGAS
A0A386K673_9CAUD      KCYASFQDKKTKETKHINLVVVDSKGKKME-DVPIIGGGSKLKVKYSLVPYKWNTAVGAS
A0A385IG14_9CAUD      KSYASFKDKKTSEMVERKIVVVDGRGKRLP-VVPAIAGGSEGKAKFSLVPYSFTAVAGAS
A0A5Q2WCJ2_9CAUD      KCYASFQDKKTKETKHINLVVVDSKGKKIQ-DVPIIGGGSKLKVKYSLVPYKWNTAVGAS
A0A385IF45_9CAUD      KSYASFKDKKTSEMVERKIVVVDGRGKRLP-VVPAIAGGSEGKAKFSLVPYSFTAVAGAS
E9KIF0_9CAUD          KCYASWKNPKTDAMQDITLRVADSKGKTMS-VVPNISGGSTLKLRYSVFPYKWNTAVGAS
A0A2U7N592_9CAUD      SGYASFLDKKTNENKAIDLRVVDSKGKRID-NVPAIAGGSEGKVRFSMFAYGFSNVAGAS
A0A6M3TA20_9CAUD      SGYASYTDTKTGENKEIVLKVVDAKGKRID-AVPAISGGSELKVRYSQFPYTFGAVVGAS
A0A0E3JQA8_9CAUD      KCYASFQDKKTKETKHINLVVVDSKGKKIQ-DVPIIGGGSKLKVKYSLVPYKWNTAVGAS
F1D0C0_9CAUD          KMYASFKDKETGEMKDLTLRVYDSQGKRIE-DVPAISGGSEGRVEFSLFAYPPSGAVGAS
                      . :.::   :          . *  .* :    * * .**  : .:. ..:     .***

A0A7D5FW54_9CAUD      VKLQLESCLLVELKEWKGDGNGGDGGWGDDEDLGTGYKASTDGDFGSDDFGDDGS-----
W6PNB4_9CAUD          VKLQLESVLLVDLVEFGAGGDSGAGGWGDDEDIGSGFKAKNDGNFDGDG-GFDGD-----
A0A2D0YYU6_9CAUD      VKLQLAKFQLLKLVEW---TGGGNDTFGDDDDEDMSAYEGGYVAS-SKPKDSFGGDDEEY
SSB_BPT7              VKLQLESVMLVELATF---GGG-EDDWADEVEENGYVASGSAKASKPRDEESWDE-----
SSB_BPT3              VKLQLESVMLVELATF---GGGGEDEWADEVEDGGYTASESRQS---RDEQEWQE-----
Q858M5_9CAUD          VKLQLESVMLVELATF---GGG-EDDWADEVEENGYVASGSAKASKPRDEESWDE-----
A0A1I9SE95_9CAUD      IKLQLESCLMVELKEWKGDGAGGDGGWGDDEDLGTGYKAPTDGDFGSDDFGDDGS-----
A0A1L7DS03_9CAUD      VKIQLDSVMLVELATS---GNG-GDWGADEAEEGGYSQQTPEERQWSQDDGEGTS-----
Q4TVX4_9CAUD          VKLQLAKFQLLKLVEW---TGGGNDTFGDDDDEDMSAYEGGYIAS-SKPKDSFGGDDEEY
A0A5J6T7Y1_9CAUD      VKLQLESVMLVELAAF---GGG-EDDWADEVEENGYVASGSAKASKPRDEESWDE-----
A0A3S9U7Z0_9CAUD      VKLQLEGVMLVELATF---GGG-EDDWADEAVEGGYEADESRSRKPQEDPEDWSG-----
A0A514A6V6_9CAUD      VKLQLDSVMLIKLVEF---GGG-DDDWGDEIEEDGYEADEAQTRQRPQN-DSGWN-----
A0A481V756_9CAUD      VKLQLESVMLVELATF---GGG-EDDWADEVEENGYVASGSAKASKPRDEESWDE-----
A0A2H1UJ76_9CAUD      VKLQLDSIMLIDLVEF---GGS-AEDWGDEVEEGGYVADNSKP-QRQQE-ESWGN-----
A0A1J0MEI0_9CAUD      VKLQLDSVMLIKLVEF---GGG-DDDWSDEIEEDGYEADEAQTRQRPQN-DSGWN-----
A0A386K673_9CAUD      VKLQLESVMLVELATF---GGG-EDDWADEVEENGYVASGSAKASKPRDEESWDE-----
A0A385IG14_9CAUD      VKLQLDSLMLLKLVEF---GAGGEGDWGDEVEEDAEDFSGRQFSNRPAPSEDEAAEDSDG
A0A5Q2WCJ2_9CAUD      VKLQLESVMLVELATF---GGGSEDEWADEVEDGGYTASESRQS---RDEQEWQE-----
A0A385IF45_9CAUD      VKLQLDSLMLLKLVEF---GAGAEGDWGDEVEEDAEDFSGRQFSNRPAPTDEPDISPDDS
E9KIF0_9CAUD          VKLQLEGVMLIDLVEF---GGGGDDDWGDAVEEGGFVAEETTQREEWQEDRSDMG-----
A0A2U7N592_9CAUD      VKLQLDSFMLLLLKEF---QAG-SDDWADETEDG-FVAEAG-SSDWDGHDDSSQS-----
A0A6M3TA20_9CAUD      VKLQLDSVMLIKLVEY---AAG-GDDWSGEEEEG-YVAPDNRDSDWS-QEDAPER-----
A0A0E3JQA8_9CAUD      VKLQLESVMLVELATF---GGGGEDEWADEVEDGGYTASESRQS---RDEQEWQE-----
F1D0C0_9CAUD          VKLQLAKFQLLKLVEW---TGGGNDTFGDDDDEDMSAYEGGYVAS-SKPKDSFGGDDEEY
                      :*:**    :: *        .     ..    .                          

A0A7D5FW54_9CAUD      EGGDDSTLVAITTSNGPMVCKTGALCGCLPLWT
W6PNB4_9CAUD          DETEESSADEDNYDF------------------
A0A2D0YYU6_9CAUD      EESDEGEEEYEEEDF------------------
SSB_BPT7              DDE-ESEEADEDGDF------------------
SSB_BPT3              DEHEETPDDDE--DF------------------
Q858M5_9CAUD          DDG-DSYEEDSDGDF------------------
A0A1I9SE95_9CAUD      EGGDEDTAGDYDF--------------------
A0A1L7DS03_9CAUD      EAD--SGDDVDDGDF------------------
Q4TVX4_9CAUD          EESDEGEEEYEEEDF------------------
A0A5J6T7Y1_9CAUD      DDDNESEEADEDGDF------------------
A0A3S9U7Z0_9CAUD      EEEADEGEAEEDDDF------------------
A0A514A6V6_9CAUD      EESEEEDEEDEDGDF------------------
A0A481V756_9CAUD      DDS-ESYEEDEDGDF------------------
A0A2H1UJ76_9CAUD      DESENEAEPDEGGDF------------------
A0A1J0MEI0_9CAUD      EEPEEED--DEDGDF------------------
A0A386K673_9CAUD      DDE-GSEEADEDGDF------------------
A0A385IG14_9CAUD      EDSDSDEE--EDGDF------------------
A0A5Q2WCJ2_9CAUD      DEHEEIPDEDE--DF------------------
A0A385IF45_9CAUD      EEGDSDED--EGGDF------------------
E9KIF0_9CAUD          HAGEDIPDADDDF--------------------
A0A2U7N592_9CAUD      RGHVDEEVPDEEDPF------------------
A0A6M3TA20_9CAUD      EGPPDSTYGDVDF--------------------
A0A0E3JQA8_9CAUD      DEHEETPDDDE--DF------------------
F1D0C0_9CAUD          EESDEGEEEYEEEDF------------------