CLUSTAL format seed alignment for MF_04157

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PRIM_BPT4             -------------MSSIPWIDNEFAYRALAHLPKFTQVNNSSTFKLRFRCPVCGDSKTDQ
A0A291LG28_9CAUD      --------------MNIIYIERQFATRLSYRMELCTDHSRGVEVKYNFRCPICGDSKTDY
A0A2Z5WLI9_9CAUD      -------------MSSIPWIDNEFAYRALAHLPKFTQVNNSSTFKLRFRCPVCGDSKTDQ
M4SRC1_9CAUD          ---------------MSNFVDVHYVNLLSGRLEKFARKKED---LYNFRCPYCGDSQKHR
A0A1D8KTB7_9CAUD      ----------------MSFIDVKYIQLVSSRLVLFSRKKAD---LYNFRCPYCGDSQKRR
A0A482MW51_9CAUD      ---------------MAEWIDNEFAYRAFSHLPRFRQINNSSTFKLTFRCPVCGDSQTDA
M4T072_9CAUD          ------------------MVDAYYVSLLSSRLDKFSRKKND---LYNFRCPYCGDSQKHK
E3SN03_9CAUD          ----------------MSYLDTKYINLASASLQKYKKVKNG---LWTFRCPYCGDSKKNK
E5DI40_9CAUD          ----------------MSWVDNEFAYRAFSHLPRFKQVTNGHRFKLNFRCPICGDSQKDQ
C9DGJ9_9CAUD          ------------------MIDSKYAMFLGPQLSGFKQIRRN---VWNSRCPKCGDSEKHK
M4T1Z2_9CAUD          ----------------MSTVDDLYINRLSIRLEKFKRVKNS---LYNFRCPFCGDSKKNK
A0A219YAA2_9CAUD      -----------------MFADFLFAERAMMHLPKFKRKKG----KFNSRCPICGDSQTDM
G8GDJ6_9CAUD          ----------------MKFLDEQYINFLAPRLDKFSWERVGA--VAKFRCPLCGDSKKSA
C3V194_9CAUD          -------------MSSIPWIDNEFAYRALAHLPKFTQVNNSSTFKLRFRCPVCGDSKTDQ
E1A1U8_9CAUD          MDFCRSIMGPRAPFGVIMFADFLFAERAMMHLPKFKRKKG----KFNSRCPICGDSMTDM
S4TTQ3_9CAUD          ----------------MKFLDEQYINFLAPRLDKFSWERVGA--VAKFRCPLCGDSKKSA
A0A097J3V4_BPR09      -------------MSSIPWIDNEFAYRALAHLPKFTQVNNSSTFKLRFRCPVCGDSKTDQ
A0A1S5R469_9CAUD      ------------MIHPKLHIDLQWMNKISIGLQRFKKVKTN---TFCCRCPVCGDSKKDT
C4MYI5_9CAUD          ---------------MIYYADYEIAEKAIYGERNFKRLHTS-SFTLVCSCPICGDSKKNH
G3M110_9CAUD          ----------------MKFLDEQYINFLAPRLDKFSWERVGA--VAKFRCPLCGDSKKSA
A0A6B9J8W2_9CAUD      ---------------MSSWIDNDYAIRLLSYERNYKLIPGMPI-RINCACPVCGDSQKDP
A0A6G8R8F0_9CAUD      -------------MSSIPWIDNEFAYRALAHLPKFTQVNNSSTFKLRFRCPVCGDSKTDQ
A0A1D7RNN5_9CAUD      -------------------------MLLSGRLEKFSRKKSG---LYNFRCPYCGDSERHR
A0A4Y5TQN0_9CAUD      ----------------MNFVDYEFAERALSVLPRYRKL-PGSTFKLNCRCPICGDSQKNQ
A0A0A0Q0H1_9CAUD      ----------------MSWVNKEFAIRALSHLPKFRQV-NGSIFKLNCRCNVCGDSEKNI
A0A0K1LQB0_9CAUD      -----------------MYLDIEFATRIMGSLPQSEIVRKSGALSINARCPICGDSMKDK
A0A097J1K5_9CAUD      -------------MSSIPWIDNEFAYRALAHLPKFTQVNNSSTFKLRFRCPVCGDSKTDQ
A0A346FJB9_BPT6       -------------MSSIPWIDNEFAYRALAHLPKFTQVNNSSTFKLRFRCPVCGDSKTDQ
A0A0K1LNF3_9CAUD      ----------------MSWVHNEFAFRALSHLPKFTQVNNAAQFKLRCRCPVCGDSQKDE
A0A2Z4QCK9_9CAUD      ---------------MAEWIDNEFAYRAFSHLPRFRQINNSSTFKLTFRCPVCGDSQTDA
R9TLI7_9CAUD          ---------------MSEFVDEYYVSLLSGRLDKFSRKKSG---LYNFRCPYCGDSQKHR
M1U2P0_9CAUD          ----------------MNYIETKYVNLLSGRLDKFARKKEG---LWNFRCPYCGDSKKYK
A0A482IHQ9_9CAUD      ------------------------------------------------------------
A0A1D8KU15_9CAUD      ----------------MDFVDSKYVNLVSSRLEKFKRTKAD---LFNFRCPICGDSSKNK
A0A097J7Q7_BPT4       -------------MSSIPWIDNEFAYRALAHLPKFTQVNNSSTFKLRFRCPVCGDSKTDQ
I6XGH0_9CAUD          ----------------MQILIDIQYAKMLQHRLLLPKVHSNRPFKINARCPICGDSKKNK
                                                                                  

PRIM_BPT4             NKARGWYYGDNN----EGN-IHCYNCN--YHAPIGIYLKEFEPDLYREYIFEIRKEKGK-
A0A291LG28_9CAUD      SKTRGWLYESEG-----HVRFGCFNCN--VNMKLSNYLYDNEPEMYREFAKEKFANKDD-
A0A2Z5WLI9_9CAUD      NKARGWYYGDNN----EGN-IHCYNCN--YHAPIGIYLKEFEPDLYREYIFEIRKEKGK-
M4SRC1_9CAUD          NKARGYFFRIKA-----DMVFKCHNCG--VGRTLPNFLKDNAPDLHDEYIMERYKNGTTG
A0A1D8KTB7_9CAUD      NKARGYLFKIKN-----DFVFKCHNCG--MGRTLANFLKDQDTFLHDQYVMEKFKDGKTG
A0A482MW51_9CAUD      MKARGWYYG-GT----PGN-VHCYNCQ--YHNTISGYLKEYDEELYREYLMEVRKEKAR-
M4T072_9CAUD          NKARGYFFRIKN-----DMVFKCHNCG--VGRTLPNFLKDQAPDLYDEYIMERYKSGTTG
E3SN03_9CAUD          NKTRGYIFQVKG-----DHVFKCHNCG--ITRSFSNFLKDQVPHVYDEYVMERYKEGTIG
E5DI40_9CAUD          FKARGWAYEQPT----GGIVVHCYNCD--AHLGLAKYLRENEPDLYREYILEVRKEQGQ-
C9DGJ9_9CAUD          KKKRFYIYQPSRKGLADFLSCACHNCG--YHDFFGEFLKSHDEPLYHEYKMELFKEKGWT
M4T1Z2_9CAUD          NKARGYFFLVKG-----RMVYKCHNCG--VGKTTANFLKDFAPDLYSEYQLEKYRMNATG
A0A219YAA2_9CAUD      NKARFWMYEKKG----DWQ-VHCFNCG--YHSNLGGYLKDREEELYREWLLERRKEN---
G8GDJ6_9CAUD          NKRRGHFFYDRDD---DVFRFKCHNCNEMSGWAFEFWLKKFDERLYNEYNLEKFRIMGDT
C3V194_9CAUD          NKARGWYYGDNN----EGN-IHCYNCN--YHAPIGIYLKEFEPDLYREYIFEIRKEKGK-
E1A1U8_9CAUD          NKARFWMYEKKG----EWQ-VHCFNCG--YHSNLGGYLKEREEELYREWLLERRKES---
S4TTQ3_9CAUD          NKRRGHFFYDRDE---DVFRFKCHNCNEMSGWSFEFWLKKFDERLYNEYNLEKFRIMGDT
A0A097J3V4_BPR09      NKARGWYYGDNN----EGN-IHCYNCN--YHAPIGIYLKEFEPDLYREYIFEIRKEKGK-
A0A1S5R469_9CAUD      KKTRFFFYVRKQ-----SLNVMCHNCG--YSKSFYNFMREQHPTQFEEYKRETLFDTFTQ
C4MYI5_9CAUD          TQARFRIYTYK-----DSLRCGCFNCN--YNQPLGEFLKQYKPDLFREWLMERRKEQGD-
G3M110_9CAUD          NKRRGHFFYDRDD---DVFRFKCHNCNEMSGWAFEFWLKKFDERLYNEYNLEKFRIMGDT
A0A6B9J8W2_9CAUD      HKARFWYFHHDN----TTF-VHCYNCD--YSSRFDRFLQERDEELYREYMMEKFKESGSG
A0A6G8R8F0_9CAUD      NKARGWYYGDNN----EGN-IHCYNCN--YHAPIGIYLKEFEPDLYREYIFEIRKEKGK-
A0A1D7RNN5_9CAUD      NKARGYFFQIKA-----DMVYKCHNCG--VGRTLPNFLKDQAPDLHDEYIMERYKSSTTG
A0A4Y5TQN0_9CAUD      MKARFWCFEVE-----GGLRVGCFNCD--YKAWFSKFLKETDETLYREFLLERRKENMY-
A0A0A0Q0H1_9CAUD      HKARFWAFETKT----GDIRLHCFNCA--YSDWLSKYLKEYEEELYREYLLEWRKEQSL-
A0A0K1LQB0_9CAUD      YKKRFWIYPSKKG---DHMNCGCFNCG--YGVPFSVFLKEYYPDDYRDYLMESFKDR---
A0A097J1K5_9CAUD      NKARGWYYGDNN----EGN-IHCYNCN--YHAPIGIYLKEFEPDLYREYIFEIRKEKGK-
A0A346FJB9_BPT6       NKARGWYYGDNN----EGN-IHCYNCN--YHAPIGIYLKEFEPDLYREYIFEIRKEKGK-
A0A0K1LNF3_9CAUD      NKARFWAYGLPD----DVL-LKCYNCD--YVKPIGIYLKEYEPDLYREFILELRKDKMV-
A0A2Z4QCK9_9CAUD      MKARGWYYG-GT----PGN-VHCYNCQ--YHNTISGYLKEYDEELYREYLMEVRKEKAR-
R9TLI7_9CAUD          NKARGYFFRLKQ-----DMVFKCHNCG--VGRTLPNFLKDNAPDLHDEYIMERYKNGTTG
M1U2P0_9CAUD          NKARGYFIRVKT-----DLVYKCHNCG--VGRSFSNFLKDQAMDLHDDYIMERYKEGLTG
A0A482IHQ9_9CAUD      -------------------MYKCHNCG--ISLNLGQFLAEIAPALLGEFKLEKFKQKNPT
A0A1D8KU15_9CAUD      TKARGYLYTVKN-----NTNFKCHNCQ--SSMSLNNFIKKLDPVLHKQYVMEKFKEGHSG
A0A097J7Q7_BPT4       NKARGWYYGDNN----EGN-IHCYNCN--YHAPIGIYLKEFEPDLYREYIFEIRKEKGK-
I6XGH0_9CAUD          YKTRFWINEVKTKSGELHLRCSCWNCD--YNESLYTFLKDHEPALFSQYRVDLFKERNSR
                                            * **          :: .       ::  :        

PRIM_BPT4             -SRP-IEKPK-ELPKQP------------EKKIIKSLPSCVRLDKLAEDHPIIKYVKARC
A0A291LG28_9CAUD      ---SEWFETKKTVEKPV------------ELITKSVIPYSTCIEDLPENHPAVKWVAARK
A0A2Z5WLI9_9CAUD      -SRP-VEKPK-ELPKQP------------EKKIIKSLPSCVRLDKLAEDNPIIKYVKARC
M4SRC1_9CAUD          KGSYVPKPKPVQFEKPK-------------FKK---KGELQSIEQLNNEHPARGYLLGRQ
A0A1D8KTB7_9CAUD      KGTTVPNPK-FEFKEPK-------------FVKR--DTGLEKISSLNISHPAREYLENRG
A0A482MW51_9CAUD      -MEPKIEKVP-EAKPEP------------EKKTINSLPSCSRLDKLPEEHPIVKYVKSRC
M4T072_9CAUD          KGSYVPKPK---FNKPK-------------FKK---KGELQSIAELNTSHPALGYILGRQ
E3SN03_9CAUD          KNVPKPDLT-QFISKPK-------------FDKK--TIDLEPLSRLNNFHVAKKYILDRG
E5DI40_9CAUD          -SRAAPKKEV-KLPPV-------------EKKFIQKLDYCERLDRLSPAHPICKYVAGRK
C9DGJ9_9CAUD          SNFDKREEAKARSTAQAAAVLERLSEVDEDAPEVEEVDWVRTLRTAPANHPVLQYAHTRL
M4T1Z2_9CAUD          KGTTVEKFT-IPDSTPK-------------FKK---PHDLKCISDLNKEHPAKKYLLDRK
A0A219YAA2_9CAUD      -NVFKPQVKTIAETFTK------------KMPVIEKLNYCTKLDTLPENHPIVKYVANRK
G8GDJ6_9CAUD          SSRPLQKLKPLQRLTQTAR-----IGSQVAKRDEEHLGNMIRLDILDHDHIARRYVEGRG
C3V194_9CAUD          -SRP-VEKPK-ELPKQP------------EKKIIKSLPSCVRLDKLAEDHPIIKYVKARC
E1A1U8_9CAUD          -TVFKPEAKPVENLFTK------------KMPVIEKLNFCDRLDLLPANHPIVKYVAKRK
S4TTQ3_9CAUD          NSRPLQKLKPLQRLTQTAR-----IGSQVAKRDEEHLGNMIRLDLLDRDHIARRYVEGRG
A0A097J3V4_BPR09      -SRP-IEKPK-ELPKQP------------EKKIIKSLPSCVRLDKLAEDHPIIKYVKARC
A0A1S5R469_9CAUD      RGYGDTPANTLVEAEPTE------IATTSGLTMEEFGELSVPMSALPDNHPAVQFLKKRA
C4MYI5_9CAUD          -HKNTTFKPLKKVE-KP------------EIKKVQTLPFCERLDTLPTNHPIIKYVSDRC
G3M110_9CAUD          SSRPLQKLKPLQRLTQTAR-----IGSQVAKRDEEHLGNMIRLDLLDRDHIARRYVEGRG
A0A6B9J8W2_9CAUD      -TSSRSAPVEVSEKLTT------------TFKVIEKLNYSTRIDTLPDSHPIVKYVSDRA
A0A6G8R8F0_9CAUD      -SRP-VEKPK-ELPKQP------------EKKIIKSLPSCVRLDKLAEDHPIIKYVKARC
A0A1D7RNN5_9CAUD      KGSYVPKPK---FEKPK-------------FKK---KGELQSIEQLNNEHPAVGYLRGRQ
A0A4Y5TQN0_9CAUD      -REKKAPSI--SEKIKA------------KMPVIKRLPNCERLDRLPADHPIIKYVKARC
A0A0A0Q0H1_9CAUD      -GRTQQPTVEVSEKIKA------------KMPIIEKLEFCERLDKLPETHPIVKYVANRK
A0A0K1LQB0_9CAUD      ----NSLKPTHTEQPKE------------EKKFIPTLQFCERLDTLPDEHPIIKYVQNRC
A0A097J1K5_9CAUD      -SRP-IEKPK-ELPKQP------------EKKIIKSLPSCVRLDKLAEDHPIIKYVKARC
A0A346FJB9_BPT6       -SRP-VEKPK-ELPKQP------------EKKIIKSLPSCVRLDKLAEDHPIIKYVKARC
A0A0K1LNF3_9CAUD      -QRE--KPVE-KPKPVV------------EETKGIKLIHCERLDKMDPNHPIVRYIAGRK
A0A2Z4QCK9_9CAUD      -MEPKIEKVP-EHKPEP------------EKKTINSLPSCSRLDKLPEEHPIVKYVKSRC
R9TLI7_9CAUD          KGSYVPKPK---FEKPK-------------FKK---KGELQSMDQLNNEHPAVGYLLGRQ
M1U2P0_9CAUD          HGRYIKNPE-LDFKTQI-------------PKRVKIPTGLKPISCLNSLHPARGYLLGRG
A0A482IHQ9_9CAUD      FGDDKKRDEQFITTTQHR-----------LRRTGTILAFCDRLLSLPEDHHARVYLDGRK
A0A1D8KU15_9CAUD      KNFSTPTPK-LDFKAPT-------------FTR----KTKIRLPKASENEQAKAYLVNRK
A0A097J7Q7_BPT4       -SRP-IEKPK-ELPKQP------------EKKIIKSLPSCVRLDKLAEDHPIIKYVKARC
I6XGH0_9CAUD          ERKEREPEPVVEKKEAT------------VIEKEQEEQLFYNITALKEGHVMHKYLESRK
                                                                :      .    :   * 

PRIM_BPT4             IPKDKWKYLWFTTEWPKLVNSIAPGTYKKE--ISEPRLVIPIYNANGKAESFQGRALKKD
A0A291LG28_9CAUD      IPKHQYKLFFFTADWKKVANSVKPETYLYDD-KKEYRLVIPIYNKDGTYSSLQGRALDPN
A0A2Z5WLI9_9CAUD      IPKDKWKYLWFTTEWPKLVNSIAPGTYKKE--IPEPRLVIPIYNASGKAESFQGRALKKD
M4SRC1_9CAUD          IPEEHFSNLFYTDKFCEWVNTQ-KPTFKDVK-KDHPRIIIPFIDTDGTWFGFQGRSLDAH
A0A1D8KTB7_9CAUD      I--KDLDYFYYCPKFKAWTNEQ-KKMFDNLK-QDSPRIIIPFRDKEGNLFGYQGRSLAPK
A0A482MW51_9CAUD      IPKESWNRLWFTLEWPKLVNKIQPGTYKKE--IPEPRLVIPIFNKDGKAESFQGRALRKD
M4T072_9CAUD          IPQKNHSDLYYTEDFCTWVNTQ-KPTFPNVK-KDHPRIIIPFIDQHGEWFGFQGRSLVPN
E3SN03_9CAUD          IPENKLDRLYYCPNFKEWTNTQ-KHTFSDIT-NDEERIIIPLNDTDGNLIGFQGRSLSPN
E5DI40_9CAUD          IPKDKWNRLWFTTQWPALVNSVNEGTYSHE--KNEPRLVIPIFNEKGKIESFQGRALSKD
C9DGJ9_9CAUD          FPDSAYDILGWCDNFQEEFGNFSDIVEKRS-LPSDPRLIIPIRNPDGELIALQGRAIGPS
M4T1Z2_9CAUD          VPESQLSRLFYAEKFKTWVNTQ-KKTFDNVQ-NDQPRIIIPLVRADGTWFGIQGRSLAKY
A0A219YAA2_9CAUD      IPKSAYSRLWFTKEWQKLVNSISPETYTRE--RSECRLVIPIFDENGDIQSFQGRALCV-
G8GDJ6_9CAUD          MPESTLSLLYYSRNFRQDLLSFETDVEKQKKIPEDERLVIPFWTQDGRMKIVQGRAFGDN
C3V194_9CAUD          IPKDKWKYLWFTTEWPKLVNSIAPGTYKKE--ISEPRLVIPIYNANGKAESFQGRALKKN
E1A1U8_9CAUD          IPESAYKRLWFTREWQKLVNSISPDTYTRE--SPENRLVIPIFDKNGEIQSFQGRALSA-
S4TTQ3_9CAUD          MPESALSLLYYSKNFRKDLLNFETDVEKQKKIPEDERLVIPFWTQDGRMKIVQGRAFGDN
A0A097J3V4_BPR09      IPKDKWKYLWFTTEWPKLVNSIAPGTYKKE--IPEPRLVIPIYNANGKAESFQGRALKKD
A0A1S5R469_9CAUD      FTQTELDRVYFTDDFKAIALAMNQESAKKLV-DDEPRILIPFTTPEGTVEVFQGRALVE-
C4MYI5_9CAUD          IPHDKWDLLYFTREWQKVANHIKADTFKNP--QPEPRLVIPIFNRENKIESIQGRALRKD
G3M110_9CAUD          MPESTLSLLYYSRNFRQDLLSFETDVEKQKKIPEDERLVIPFWTQDGRMKIVQGRAFGDN
A0A6B9J8W2_9CAUD      IPKEKWNRLWFTAQWQDLCNSIKPGTFETP--KPEYRLVIPIFNKKGEIESIQGRALKP-
A0A6G8R8F0_9CAUD      IPKDKWKYLWFTTEWPKLVNSIAPGTYKKE--ISEPRLVIPIYNANGKAESFQGRALKKD
A0A1D7RNN5_9CAUD      IPKEHFGDLYYTDTFCTWVNTQ-KPTFKDVK-KDHPRIIIPFIDTNGEWFGFQGRSLNAD
A0A4Y5TQN0_9CAUD      IPEVNWKRLWFTMEWPALVNSVNPGTYKDE--KSEPRLVIPIFNARGDIESFQGRALRKN
A0A0A0Q0H1_9CAUD      IPKERWNRLWFTNNWQALCNSIKPGTYANE--KNEPRLVIPIYNVNKEIESFQGRALRKD
A0A0K1LQB0_9CAUD      IPRDKWDRLWFTREWQQLVNTVNPDTYPIA--KPEPRLVIPIFDKKGKIESFQGRALR-D
A0A097J1K5_9CAUD      IPKDKWKYLWFTTEWPKLVNSIAPGTYKKE--IPEPRLVIPIYNANGKAESFQGRALKKD
A0A346FJB9_BPT6       IPKDKWKYLWFTTEWSKLVNSIAPGTYKKE--IPEPRLVIPIYNVNGKAESFQGRALKKD
A0A0K1LNF3_9CAUD      IPKDKWNRLYFTLKWPALVNSVNPDTYKTE--RDEPRLVIPIFNSEGIIESFQGRALRKD
A0A2Z4QCK9_9CAUD      IPKESWNRLWFTLEWPKLVNKIQPGTYKKE--IPEPRLVIPIFNKDGKAESFQGRALRKD
R9TLI7_9CAUD          IPKEHFSNLYYTDKFCTWVNTQ-KPTFKDVK-KDHPRIIIPFIDTQGEWFGFQGRSLTAD
M1U2P0_9CAUD          IPEQFFEELFYVDKFQEWVNKQ-KPTFENDK-YEHGRIIIPLVR-DGSWYGFQGRSLNPN
A0A482IHQ9_9CAUD      IPESNQSKLFYIDDVRVLAKNIPGYGERAAKLPKRDAIIIPFFDEDGALMYLQCRFFDEN
A0A1D8KU15_9CAUD      LD---PDKFYYTAGFKKWANTL-TKAFDSTQ-YDDARIVIPLYTADGDLFGFQGRALGP-
A0A097J7Q7_BPT4       IPKDKWKYLWFTTEWPKLVNSIAPGTYKKE--ISEPRLVIPIYNANGKAESFQGRALKKD
I6XGH0_9CAUD          IPKDKWHLLGFTRGWTTMAKTLRPDLYEGEIKNDHPRLVIPIYNKDG-LVAVQGRALTNK
                      .       . :                          ::**:          * * :   

PRIM_BPT4             APQ---KYITIEAYPEATKIYGVERVKDG--DVYVLEGPIDSLFIENGIAITGG----QL
A0A291LG28_9CAUD      VDKSR-RYLTIKADDKASKVYGMERVDPSK-TVWMLEGPIDSVFIPNACAIVGG----VM
A0A2Z5WLI9_9CAUD      APQ---KYITIKAYPEATKIYGVERVKDG--DVYVLEGPIDSLFIENGIAITGG----QL
M4SRC1_9CAUD          DKM---RYITIMLDESKTKIFGLNKVDFNK-TIYITEGPFDSLYIDNAIAMAGA----DV
A0A1D8KTB7_9CAUD      AKL---RYITIMLDEEQPKIFGLDRVKENK-PVYIVEGPFDATFLENSVAMAGS----DA
A0A482MW51_9CAUD      APQ---KYITIKAFESATKIYGVERVKEG--DVWVMEGPIDSLFIPNAIAITGG----SI
M4T072_9CAUD          DPM---RYITIMLDEDRTKVFGLDRVDFNK-TIYITEGPFDSFYIDNAIAMAGA----DI
E3SN03_9CAUD          AKM---RYITVMLNEDAPKLYGLDHINKNE-TIYIVEGPLDSFFLENAVAMCGS----DV
E5DI40_9CAUD          APQ---KYMTIKAHELATKIYGQDTVDPNK-LVFVMEGPLDSLFINNAIAITGG----SI
C9DGJ9_9CAUD          ELR----YITLKMEETASKVFGLDRLKPGL-PTIVVEGPLDSLFLPNCIATADA----NL
M4T1Z2_9CAUD          TTL---RYITVMF-EDHQKVFGLDTINKNE-KVYVTEGPLDSLFMDNAIAMCGA----DV
A0A219YAA2_9CAUD      SPN---KYITIKAHEDASKIYGMDTIDGNR-MVWLMEGPLDSLFIPNAGAITGG----SL
G8GDJ6_9CAUD          LPDGVLRYATVKPKNEDTKIYGEERIIWNK-TKLVVEGPIDSLFLPNCLATADA----DL
C3V194_9CAUD          APQ---KYITIKAYPEATKIYGVERVKDG--DVYVLEGPIDSLFIENGIAITGG----QL
E1A1U8_9CAUD          SPN---KYITIKAHEDASKISEWTQLMGTE-LYGLWKDRLTPFSF---------------
S4TTQ3_9CAUD          LPDNVLRYATVKPKNEDTKIYGEERIIWNK-TKLVVEGPIDSLFLPNCLATADA----DL
A0A097J3V4_BPR09      APQ---KYITIKAYPEATKIYGVERVKDG--DVYVLEGPIDSLFIENGIAITGG----QL
A0A1S5R469_9CAUD      SKM---KYITIKAHDDVVKVYGRYWLDRSK-TTYCVEGPIDSMFVDNCIATCDA----NL
C4MYI5_9CAUD          YGKT--KYMTIKTHELASKVYGLERADPSK-PVYFLEGPIDSLFIDNGCAITGG----TL
G3M110_9CAUD          LPDGVLRYATVKPKNEDTKIYGEERIIWNK-TKLVVEGPIDSLFLPNCLATADA----DL
A0A6B9J8W2_9CAUD      SNI---KYMTIKAHEHASKVYGQDTIDESKDFVFVMEGPIDSLFLENALAITGG----SL
A0A6G8R8F0_9CAUD      APQ---KYITIKAYPEATKIYGVERVKDG--DVYVLEGPIDSLFIENGIAITGG----QL
A0A1D7RNN5_9CAUD      DKL---RYITIMLDESRIKVFGLNRVDFKK-TVYITEGPIDSLYIDNAIAMAGA----DV
A0A4Y5TQN0_9CAUD      APQ---KYITIKAHEHATKIYGLDTVDESR-LVWVMEGPIDSLFIPNAIAITGG----SM
A0A0A0Q0H1_9CAUD      APQ---KYITIKSNEDATKIYGLDTTDDRK-RVWVMEGPIDSLFIPNAIAITGG----QL
A0A0K1LQB0_9CAUD      GAKS--KYITIKACEESTKIYGQDTIDPLK-TVYLLEGPLDSLFVDNAGAITGG----QL
A0A097J1K5_9CAUD      APQ---KYITIKAYPEATKIYGVERVKDG--DVYVLEGPIDSLFIENGIAITGG----QL
A0A346FJB9_BPT6       APQ---KYITIKAYPEATKIYGVERVKDG--DVYVLEGPIDSLFIENGIAITGG----QL
A0A0K1LNF3_9CAUD      APQ---KYITIKSNEHATKIYGTDTAKPGK-NVYVLEGPIDSLFLDNAIAITGG----AM
A0A2Z4QCK9_9CAUD      APQ---KYITIKAFESATKIYGVERVKEG--DVWVMEGPIDSLFIPNAIAITGG----SI
R9TLI7_9CAUD          DKL---RYITIMLDESRIKVFGLDRVDFKK-TVYITEGPIDSLYIDNAIAMAGA----DV
M1U2P0_9CAUD          DTM---RYITIILDETQPKIYGIDRTDKNK-VTYITEGPFDSLFLDNAVAMVGA----DI
A0A482IHQ9_9CAUD      FRY-----MTFQIEDEGKKIWGLDRVDWSK-RVYVCEGPFDAMFLDNCVAVAGAGIMSEI
A0A1D8KU15_9CAUD      SKV---KYITIMLNDDHPKVYGMDTVDTNK-TVYVVEGPFDSTFVNNCIAMCGA----DV
A0A097J7Q7_BPT4       APQ---KYITIKAYPEATKIYGVERVKDG--DVYVLEGPIDSLFIENGIAITGG----QL
I6XGH0_9CAUD          HAQ---RYMTIKIDDDFDKIYGTERINEED-PVIFVEGPIDSLFLYNCCAIVGG----QV
                               *.       *:                :. : .  .               

PRIM_BPT4             DLEVVPFKDRRVWVLDNEPRHP-DTIKRMTKLVDAGERVMFWDKSP---WKSKDVNDMIR
A0A291LG28_9CAUD      ALEDAPFPDKRVWVLDKEGRSF-DTLKRIENLIKAGEKVVIWDECP---WSSKDINDFIK
A0A2Z5WLI9_9CAUD      DLEIVPFKDRRVWVLDNEPRHP-DTIKRMTKLVDAGERVMFWDKSP---WKSKDVNDMIR
M4SRC1_9CAUD          DWELLRDK-EVVFVYDNEKRNK-EIIKRIEKVIDKGYEVVIWPDNLQQ----KDLNDMF-
A0A1D8KTB7_9CAUD      DVRTFGWS-NYIWIFDNEPRNR-EIVARISKVIDRGDKVVIWPKKIQQ----KDINDMV-
A0A482MW51_9CAUD      DLDVVPFKERRVWVMDNEPRHP-DTIARMKRLVDAGERVMFWDRAP---WRSKDVNDMVM
M4T072_9CAUD          DWDLLKDR-DVVFVFDNEKRNS-EIVNRMVKVIDRGHEVVIWPDKIQE----KDLNDMF-
E3SN03_9CAUD          DIRSFGWS-DYIWVYDNEPRSR-QITNKISKSIDAGDAVVIWPRSIKE----KDLNDMV-
E5DI40_9CAUD          ELSMVPYEGNRAWIMDHEPRHP-DTIKRMKKLIDAGERVVFWDKSP---WSSKDVNDMIM
C9DGJ9_9CAUD          ----LAAGIGDILVPDKQMRNA-ELIKVIERMIDSGKYVALLEDDVFP---FKDINAAIQ
M4T1Z2_9CAUD          DLSSWDY--DFVYVYDNEPRNR-QIIERMEKSISKQDNIVIWPKNVRE----KDINDMV-
A0A219YAA2_9CAUD      ALNEVPWKSTRVWVLDNEPFHP-DTCKRLSRLIDSGERVVMWDKCP---WPSKDINDMII
G8GDJ6_9CAUD          -----LSAKGDIYIPDNQYRNK-QVCDGIQKMIDSGVKVVLFPPEIPW----KDINDMVR
C3V194_9CAUD          DLEIVPFKDRRVWVLDNEPRHP-DTIKRMTKLVDAGERVMFWDKSP---WKSKDVNDMIR
E1A1U8_9CAUD          ------------------------------RILELSLAVVLH------------------
S4TTQ3_9CAUD          -----LSAKGDIYIPDNQYRNK-QVCDGIQKMIDSGVKVVLFPPEIPW----KDINDMVH
A0A097J3V4_BPR09      DLEIVPFKDRRVWVLDNEPRHP-DTIKRMTKLVDAGERVMFWDKSP---WKSKDVNDMIR
A0A1S5R469_9CAUD      ----IRSD-ADVLIFDNQCRNK-DVCKYMEQAIEEGRSLVIWPFSPSKKIDINDMVKMG-
C4MYI5_9CAUD          GLDEIPFPDQRVFVLDAEPRSA-DTMHRLEKFINAGEKIVLWDRCP---WHSKDVNAMIQ
G3M110_9CAUD          -----LSAKGDIYIPDNQYRNK-QVCDGIQKMIDSGVKVVLFPPEIPW----KDINDMVR
A0A6B9J8W2_9CAUD      SLDQVPYPEKRIWVLDNECRHP-DTVKRMNKLIDAGERVCFWDNAP---WQSKDVNDMIV
A0A6G8R8F0_9CAUD      DLEVVPFKDRRVWVLDNEPRHP-DTIKRMTKLVDAGERVMFWDKSP---WKSKDVNDMIR
A0A1D7RNN5_9CAUD      DWSLLSES-EVVFVYDNEKRNK-EIIKRMEKAIEKGYEIVIWPENLQE----KDLNDMY-
A0A4Y5TQN0_9CAUD      DLNTVPFKENRAWIMDNEPRHE-DTIKRMKRLVEAGERVVFWDNAP---WASKDINDMIK
A0A0A0Q0H1_9CAUD      ALDMVPFKETRVWVMDSEQRHK-DTIKRMERLIEAGEKIVFWDKCQ---WPSKDINEMIM
A0A0K1LQB0_9CAUD      ALSEVPYKNMRVWVLDNEARHP-DTTHRLFKLIEAGEKVVMWDKCP---WPSKDINEMIK
A0A097J1K5_9CAUD      DLEIVPFKDRRVWVLDNEPRHP-DTIKRMTKLVDAGERVMFWDKSP---WKSKDVNDMIR
A0A346FJB9_BPT6       DLEVVPFKDRRVWVLDNEPRHP-DTIKRMTKLVDAGERVMFWDKSP---WKSKDVNDMIR
A0A0K1LNF3_9CAUD      DLSLVPFKEDRVWIMDHEPRKD-DTIKRMKRLIDAGERVVFWDKAP---WEKKDINDMIQ
A0A2Z4QCK9_9CAUD      DLDVVPFKERRVWVMDNEPRHP-DTIARMKRLVDAGERVMFWDRAP---WRSKDVNDMVM
R9TLI7_9CAUD          DWNLLSDA-EVVFVYDNEKRNK-EIISRMEKAIDKGYEIVIWPDNLQE----KDLNDMF-
M1U2P0_9CAUD          EWSFADDR-DVVFIYDNEPRNG-EIISRMEKVIDRGHKIVIWPSSVED----KDINEMV-
A0A482IHQ9_9CAUD      EFFQSKAKAGLTLIFDKDYRTNFEVHRFMCQAVEKGHSVVLFDKEFKG----KDMNDQIQ
A0A1D8KU15_9CAUD      DLDTLQIK-DLVYVYDNEPRNK-EICARIEKAIKQGKKVVIFPSRIIE----KDLNDMV-
A0A097J7Q7_BPT4       DLEVVPFKDRRVWVLDNEPRHP-DTIKRMTKLVDAGERVMFWDKSP---WKSKDVNDMIR
I6XGH0_9CAUD          SPNNAPYAGNRIWALDNECRHP-DVIKRMQTLIRAGERVVIWDKLPPQIIGKKDINDFI-
                                                      :     : :                   

PRIM_BPT4             --KEGATPEQIMEYMKNNIAQGLMAKMRLSKYAKI---------------
A0A291LG28_9CAUD      --NDGATIDEVVQYLKDHTYSGLRAELALSKWRKFGHKRIS---------
A0A2Z5WLI9_9CAUD      --KEGASHEQIMEYMKNNIAQGLMAKMRLSKYAKI---------------
M4SRC1_9CAUD          -----IAGHDVQSLVEFNTYSGLQAQIKLSEWKKV---------------
A0A1D8KTB7_9CAUD      -----LAGHNVQDVVDSNVYSGLEATLKFNDWKKV---------------
A0A482MW51_9CAUD      --KENATPQEILEYMKQNISSGLHAKMRLSRYSKI---------------
M4T072_9CAUD          -----IAGHDVQSLVEFNTYSGLQAQIKLSEWKKV---------------
E3SN03_9CAUD          -----TSGINVKNVIQSNVYQGLKAKLQLSSWKI----------------
E5DI40_9CAUD          --KEGATPEQIMDYINNNIESGLMAKMRFTRYAKI---------------
C9DGJ9_9CAUD          ---GGWTPSQVLNVIIDSAKKGLAAQLQLSKLRRV---------------
M4T1Z2_9CAUD          -----LAGLDPSAIIYSNTYNGLEAKLKFTDWKRV---------------
A0A219YAA2_9CAUD      --KDGATPEEIEKYFKDNIVSGLQAKLRFGKWKRA---------------
G8GDJ6_9CAUD          PDKGNIPIRDLLQIIAKNVYQGLSASLRFSDLRKI---------------
C3V194_9CAUD          --KEGATPEQIMEYMKNNIAQGLMAKMRLSKYAKI---------------
E1A1U8_9CAUD          --------------------------------------------------
S4TTQ3_9CAUD          PDKGNIPIRDLLQIIAKNVYQGLAASLRFSDLRKI---------------
A0A097J3V4_BPR09      --KEGATPEQIMEYMKNNIAQGLMAKMRLSKYAKI---------------
A0A1S5R469_9CAUD      -----ITRAQLMSVIKQSTFKGLTAKMKFMQWKRL---------------
C4MYI5_9CAUD          --DEGATRDQIMEYIKENTVQGLMAKMRFMKYCKF---------------
G3M110_9CAUD          PDKGNIPIRDLLQIIAKNVYQGLSASLRFSDLRKI---------------
A0A6B9J8W2_9CAUD      --KEGAKASDIQEYILQNSESGLMAQVRMTQFCKI---------------
A0A6G8R8F0_9CAUD      --KEGATPEQIMEYMKNNIAQGLMAKMRLSKYAKI---------------
A0A1D7RNN5_9CAUD      -----IAGHDVQSLVEFNTYSGLEAQIKLSEWKKV---------------
A0A4Y5TQN0_9CAUD      --DEGATPEEILKYLNMNIASGLMAKMRLSRYAKV---------------
A0A0A0Q0H1_9CAUD      --KDGATVEQILEYMNSNVAEGLMAKMRLSRYSRA---------------
A0A0K1LQB0_9CAUD      --TDGATKLEIMQYLKDNTVSGLTAKLRFKSWDKSPKK------------
A0A097J1K5_9CAUD      --KEGATPEQIMEYMKNNIAQGLMAKMRLSKYAKI---------------
A0A346FJB9_BPT6       --KEGATPEQIMEYMKNNIAQGLMAKMRLSKYAKI---------------
A0A0K1LNF3_9CAUD      --KEGARIEDIQSYIENNIASGLMAQLRLKKYSKIGV-------------
A0A2Z4QCK9_9CAUD      --KENATPQEILEYMKQNISSGLHAKMRLSRYSKI---------------
R9TLI7_9CAUD          -----IAGHDVQSLVEFNTYSGLQAKIKLSEWKKV---------------
M1U2P0_9CAUD          -----QTGHNVKNLIESNTYAGLSAKVTLNNWKRV---------------
A0A482IHQ9_9CAUD      --KHFWTREYLKTYVDAHTYKGLSAKLELTKIRPPKNAFKSKSNSGRFGS
A0A1D8KU15_9CAUD      -----LQGIDANSMLESNTYQSLTATIKYNEWKRL---------------
A0A097J7Q7_BPT4       --KEGATPEQIMEYMKNNIAQGLMAKMRLSKYAKI---------------
I6XGH0_9CAUD          --KAGVSAEFIQQYIYENAVSGLMATNRLNRWKKI---------------