CLUSTAL format seed alignment for MF_04202

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

VME1_BC279      -MTDNG------TITVEELKQLLEQWNLVIGFIFLAWIMLLQFAYSNRNRFLYIIKLVFL
VME1_CVHSA      -MADNG------TITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFL
VME1_BCRP3      -MAENG------TISVEELKRLLEQWNLVIGFIFLAWIMLLQFAYSNRNRFLYIIKLVFL
VME1_BCHK3      -MADNG------TITVEELKQLLEQWNLVIGFIFLAWIMLLQFAYSNRNRFLYIIKLVFL
VME1_BCHK9      -MSNNCTN----TVPRPEVIAALKDWNFAVSVILLFITVLLQWGYPSRCKPIWVIKMFIL
VME1_CVEMC      -MSNMT------QLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMTVYVFKMFVL
VME1_BCHK5      MASSNV------TLSNDEVLRLVKDWNFTWSVVFLLITIVLQYGYPSRSMFVYVIKMFVL
VME1_BCHK4      -MSSNG------SLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFIL
VME1_BC133      -MSSNG------SLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFIL
VME1_CVHN1      -MNKSFLP----QFTSDQAVTFLKEWNFSLGVILLFITIILQFGYTSRSMFVYLIKMIIL
VME1_CVHN2      -MNESIFP----HWNSDQAITFLKEWNFSLGVILLLITIILQFGYTSRSMFVYLIKMIIL
VME1_CVHN5      -MNESIFP----HWNSDQAITFLKEWNFSLGVILLLITIILQFGYTSRSMFVYLIKMIIL
VME1_CVM2       MNSTTQAPQPVYQWTADEAIRFLKEWNFSLGIILLFVTIILQFGYTSRSMFVYVVKMILL
VME1_CVRSD      MSSTTPAPQTVYQWTADVAVRFLKEWNFLLGIILLFITIILQFGYTSRSMFIYVVKMIIL
VME1_CVMJH      MSSTTQAPGPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSMFIYVVKMIIL
VME1_CVMA5      MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSMFIYVVKMIIL
VME1_CVP67      -MSSPTTPVPVISWTADEAIKFLKEWNFSLGIIVLFITIILQFGYTSRSMFVYVIKMVIL
VME1_CVPIA      -MSSPTTPVPVISWTADEAIKFLKEWNFSLGIIVLFITIILQFGYTSRSMFVYVVKMVIL
VME1_CVHOC      -MSSKTTPAPVYIWTADEAIKFLKEWNFSLGIILLFITIILQFGYTSRSMFVYVIKMIIL
VME1_CVBEN      -MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITVILQFGYTSRSMFVYVIKMVIL
VME1_CVBLU      -MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITVILQFGYTSRSMFVYVIKMIIL
VME1_CVBLY      -MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITIILQFGYTSRSMFVYVIKMIIL
VME1_CVBF       -MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITIILQFGYTSRSMFVYVIKMIIL
VME1_CVBM       -MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITIILQFGYTSRSMFVYVIKMIIL
VME1_CVBQ       -MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITIILQFGYTSRSMFVYVIKMIIL
VME1_CVBLS      -MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITVILQFGYTSRSMFVYVIKMIIL
VME1_CVBOK      -MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITVILQFGYTSRSMFVYVIKMIIL
                                      :::**:  ..:.*   ::**:.*..*   :::.*:..*

VME1_BC279      WLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNP
VME1_CVHSA      WLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNP
VME1_BCRP3      WLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNP
VME1_BCHK3      WLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNP
VME1_BCHK9      WLLWPLSIAAAVFAAIHPINSVAFGFAIAFACISGIMWLSYFISSFRLLCRTGSAWSFMP
VME1_CVEMC      WLLWPSSMALSIFSAVYPIDLASQIISGIVAAVSAMMWISYFVQSIRLFMRTGSWWSFNP
VME1_BCHK5      WLLWPASMALSIFCAVYPIDLASQIISGILAATSCAMWISYFVQSIRLFMRTGSWWSFNP
VME1_BCHK4      WLLWPASMALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNP
VME1_BC133      WLLWPASMALSIFSAIYPISLASQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNP
VME1_CVHN1      WLMWPLTITLTIFNCFYALNNAFLAFSIVFTIISIVIWILYFVNSIRLFIRTGSWWSFNP
VME1_CVHN2      WLMWPLTIILTIFNCFYALNNIFLGLSILFTIISIVIWILYFVNSIRLFIRTGSWWSFNP
VME1_CVHN5      WLMWPLTIILTIFNCFYALNNVFLGLSILFTIISIVIWILYFVNSIRLFIRTGSWWSFNP
VME1_CVM2       WLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIIMWIMYFVNSIRLFIRTGSWWSFNP
VME1_CVRSD      WLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVMWIMYFVNSIRLFIRTGSWWSFNP
VME1_CVMJH      WLMWPLIIVLCMFNCVYALNNVYLGFSIVFTIVSVVMWIMYFVNSIRLFIRTGSWWSFNP
VME1_CVMA5      WLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIMYFVNSIRLFIRTGSWWSFNP
VME1_CVP67      WLMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWVVYFVNSIRLFIRTGSWWSFNP
VME1_CVPIA      WFMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWVVYFVNSIRLFIRTGSWWSFNP
VME1_CVHOC      WLMWPLTIILTIFNCVYALNNVYLGLSIVFTIVAIIMWIVYFVNSIRLFIRTGSFWSFNP
VME1_CVBEN      WLMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNP
VME1_CVBLU      WLMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNP
VME1_CVBLY      WLMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNP
VME1_CVBF       WLMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNP
VME1_CVBM       WLMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNP
VME1_CVBQ       WLMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNP
VME1_CVBLS      WLMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNP
VME1_CVBOK      WLMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNP
                *::**  :   :: ..: :.     ::  .:     :*: **: *:**: ** * *** *

VME1_BC279      ETNILLNVPLRGTILTRPLLESELVIGAVIIRGHLRMAGHSLGR-CDIKDLPKEITVATS
VME1_CVHSA      ETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRMAGHSLGR-CDIKDLPKEITVATS
VME1_BCRP3      ETNILLNVPLRGTILTRPLMESELVIGAVIIRGHLRMAGHSLGR-CDIKDLPKEITVATS
VME1_BCHK3      ETNILLNVPLRGTILTRPLMESELVIGAVIIRGHLRMAGHSLGR-CDIKDLPKEITVATS
VME1_BCHK9      ETDMLINIPLLGRTVTRPIISDSPAVQFLIIRGELRFDGFTLGR-CDPGDMPDIVTIARP
VME1_CVEMC      ETNCLLNVPFGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGA-CDYDRLPNEVTVAKP
VME1_BCHK5      ESNCLLNVPIGGTTVVRPLVEDSTSVTAVVTDGYLKMAGMHFGA-CDFQRLPSEVTVAKP
VME1_BCHK4      ESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGR-CDYDRLPMEITVAKP
VME1_BC133      ESNCLLNVPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGR-CDYDRLPMEITVAKP
VME1_CVHN1      ETNNLMCIDMKGKMFVRPVIEDYHTLTATVIRGHLYIQGVKLGTGYTLSDLPVYVTVAKV
VME1_CVHN2      ETNNLMCIDMKGKMYVRPVIEDYHTLTATVIRGHLYIQGVKLGTGYTLADLPVYVTVAKV
VME1_CVHN5      ETNNLMCIDMKGKMYVRPVIEDYHTLTATVIRGHLYIQGVKLGTGYTLADLPVYVTVAKV
VME1_CVM2       ETNNLMCTDMKGTVYVRPIIEDYHTLTATIIRGHLYMQGVKLGTGFSLSDLPAYVTVAKV
VME1_CVRSD      ETNNLMCIDVKGTVYVRPIIEDYHTLTATNVRGHLYMQGVKLGTGFSLSDLPAYVTVAKV
VME1_CVMJH      ETNNLMCIDMKGTVYVRPIIEDYHTLTATIIRGHFYMQGVKLGTGFSLSDLPAYVTVAKV
VME1_CVMA5      ETNNLMCIDMKGTVYVRPIIEDYHTLTATIIRGHLYMQGVKLGTGFSLSDLPAYVTVAKV
VME1_CVP67      ETNNLMCIDMKGRMYVRPIIEDYHTLTATIIRGHLYIQGIKLGTGYSLSDLPAYVTVAKV
VME1_CVPIA      ETNNLMCIDMKGRMYVRPIIEDYHTLTATIIRGHLYIQGIKLGTGYSLSDLPAYVTVAKV
VME1_CVHOC      ETNNLMCIDMKGTMYVRPIIEDYHTLTVTIIRGHLYIQGIKLGTGYSWADLPAYMTVAKV
VME1_CVBEN      ETNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKV
VME1_CVBLU      ETNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKV
VME1_CVBLY      ETNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKV
VME1_CVBF       ETNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKV
VME1_CVBM       ETNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKV
VME1_CVBQ       ETNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKV
VME1_CVBLS      ETNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKV
VME1_CVBOK      ETNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKV
                *:: *:   . *   .**::..   :      * : : *  :*       :*  :*:*  

VME1_BC279      RTLSYYKLGASQRVGNDSGFAAYNRYRIGNYKLNTDHSGSNDNIALLVQ--
VME1_CVHSA      RTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ--
VME1_BCRP3      RTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHSGSNDNIALLVQ--
VME1_BCHK3      RTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHSGSNDNIALLVQ--
VME1_BCHK9      NALHWYKRALTRNMYTRSAILVYIKYKVGNHRVQN-TTEDGDRLAMFVA--
VME1_CVEMC      NVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPP--ITADIELALLRA--
VME1_BCHK5      NVLIALKMIKRQAYGTNSGVAIYHRYKAGNYRRPP--IIQDQELALLRA--
VME1_BCHK4      SVLIALKMVKRQSYGTNSGVAIFHRYKAGNYRRPT--IIQDEELALLRA--
VME1_BC133      SVLIALKMVKRQSYGTNSGVAIFHRYKAGNYRRPT--IIQDEELALLRA--
VME1_CVHN1      QVLCTYKRAFLDKLDVNSGFAVFVKSKVGNYRLPS-SKPSGMDTALLRA--
VME1_CVHN2      QVLCTYKRAFLDKLDVNSGFAVFVKSKVGNYRLPS-SKSSGMDTALLRA--
VME1_CVHN5      QVLCTYKRAFLDKLDVNSGFAVFVKSKVGNYRLPS-SKSSGMDTALLRA--
VME1_CVM2       SHLCTYKRAFLDKVDGVSGFAVYVKSKVGNYRLPS-NKPSGMDTALLRI--
VME1_CVRSD      SHLCTYKRAFLDKVDGVSGFAVYVKSKVGNYRLPS-NKPSGADTALLRI--
VME1_CVMJH      SHLCTYKRAFLDKVDGVSGFAVYVKSKVGNYRLPS-NKPSGADTVLLRI--
VME1_CVMA5      SHLCTYKRAFLDKVDGVSGFAVYVKSKVGNYRLPS-NKPSGADTALLRI--
VME1_CVP67      THLCTYKRGFLDRIGDTSGFAVYVKSKVGNYRLPSTHKGSGMDTALLRNNI
VME1_CVPIA      THLCTYKRGFLDRIGDTSGFAVYVKSKVGNYRLPSTHKGSGMDTALLRNNI
VME1_CVHOC      THLCTYKRGFLDRISDTSGFAVYVKSKVGNYRLPSTQKGSGMDTALLRNNI
VME1_CVBEN      SHLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGLDTALLRNNI
VME1_CVBLU      SHLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGLDTALLRNNI
VME1_CVBLY      SHLLTYKRGFLDRIGDTSGFAVYVKSKVGNYRLPSTQKGSGMDTALLRNNI
VME1_CVBF       SHLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGMDTALLRNNI
VME1_CVBM       SHLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGMDTALLRNNI
VME1_CVBQ       SHLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGMDTALLRNNI
VME1_CVBLS      SHLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGMDTALLRNNI
VME1_CVBOK      SHLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGMDTALLRNNI
                  *   *          *..  : . . **:.        .   .::