CLUSTAL format seed alignment for MF_04204

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

VEMP_BCHK9      MY--DIVGTNNSILIANVLVLIIICLLVVIVGCALLLILQFVFGVCGFVFKFVCKPTILV
VEMP_CVHN1      MV--DLFFNDTAWYIGQILVLVLFCLISLIFVVAFLATIKLCMQLCGFCNFFIISPSAYV
VEMP_CVHN2      MV--DVFFTDTAWYVGQIFFLVLSCVIFLIFVVALLATIKLCIQICGFCNIFIISPSAYV
VEMP_CVHN5      MV--DVFFTDTAWYVGQIFFLVLSCVIFLIFVVALLATIKLCIQICGFCNIFIISPSAYV
VEMP_CVHOC      MFMADAYLADTVWYVGQIIFIVAICLLVTIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV
VEMP_CVP67      MFMADAYLADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV
VEMP_CVPIA      MFMADAYLADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV
VEMP_CVBM       MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLGLSPSIYV
VEMP_CVBEN      MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV
VEMP_CVBF       MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV
VEMP_CVBLS      MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV
VEMP_CVBLU      MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV
VEMP_CVBLY      MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV
VEMP_CVBOK      MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV
VEMP_CVBON      MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV
VEMP_CVBQ       MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV
VEMP_CVMA5      MF--NLFLTDTVWYVGQIIFIFAVCLMVTIIVVAFLASIKLCIQLCGLCNTLVLSPSIYL
VEMP_CVMJH      MF--NLFLTDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKRCIQLCGLCNTLLLSPSIYL
VEMP_CVRSD      MF--NLFLIDTVWYVGQIIFIVAVCLMVTIIVVAFLASIKLCIQLCGLCNTLLLSPSIYV
VEMP_CVMS       MF--NLFLTDTVWYVGQIIFIVAVCLMVTITVVAFLASIKLCIQLCGLCNTLVLSPSIYL
VEMP_CVHSA      MY--SFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYV
VEMP_BCHK3      MY--SFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYV
VEMP_BCRP3      MY--SFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYV
VEMP_BC279      MY--SFVSEETGTLIVNSVLLFFAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYV
VEMP_CVEMC      ML--PFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCMTGFNTLLVQPALYL
VEMP_BCHK5      ML--PFVQEQIGAFIVNFFILSVVCAVTLVVCLAILTAIRLCVQCVSGCHTLVFLPAVHI
VEMP_BCHK4      ML--PFVHEQIGTIIVNFFILTVVCAITLVVCLAILTAIRLCVQCASGVNTLLFVPAFYI
VEMP_BC133      ML--PFVHEQIGTIIVNFFILTVVCAITLLVCLAVLTAIRLCVQCASGVNTLLFVPAFYI
                *             : : ..:     :  :   *.*   .               *:  :

VEMP_BCHK9      YNKFRNESL----LNEREELLCDNV-----
VEMP_CVHN1      YKRGMQLYKSYS-EQVIPPTSDYLI-----
VEMP_CVHN2      YNRGRQLYKSYS-EHVIPSTLDDLI-----
VEMP_CVHN5      YNRGRQLYKSYS-EHVIPSTLDDLI-----
VEMP_CVHOC      FNRGRQFYEFYN-DVKPPVLDVDDV-----
VEMP_CVP67      FNRGRQFYEFYN-DVKPPVLDVDDV-----
VEMP_CVPIA      FNRGRQFYEFYN-DVKPPVLDVDDV-----
VEMP_CVBM       FNRGRQFYEFYN-DVKPPVLDVDDV-----
VEMP_CVBEN      FNRGRQFYEFYN-DVKPPVLDVDDV-----
VEMP_CVBF       FNRGRQFYEFYN-DVKPPVLDVDDV-----
VEMP_CVBLS      FNRGRQFYEFYN-DVKPPVLDVDDV-----
VEMP_CVBLU      FNRGRQFYEFYN-DVKPPVLDVDDV-----
VEMP_CVBLY      FNRGRQFYEFYN-DVKPPVLDVDDV-----
VEMP_CVBOK      FNRGRQFYEFYN-DVKPPVLDVDDV-----
VEMP_CVBON      FNRGRQFYEFYN-DVKPPVLDVDDV-----
VEMP_CVBQ       FNRGRQFYEFYN-DVKPPVLDVDDV-----
VEMP_CVMA5      YDRSKQLYKYYNEEMRLPLLEVDDI-----
VEMP_CVMJH      YNRSKQLYKYYNEEVRPPPLEVDDNIIQTL
VEMP_CVRSD      YNRSKQLYKYYNEEVRPPPLEVDDIIIQTL
VEMP_CVMS       YDRSKQLYKYYNEEVRPPPLEVDDIIIQTL
VEMP_CVHSA      YSRVKNLNSS---EGVPDLLV---------
VEMP_BCHK3      YSRVKNLNSS---EGVPDLLV---------
VEMP_BCRP3      YSRVKNLNSS---EGVPDLLV---------
VEMP_BC279      YSRVKNLNSS---EGVPDLLV---------
VEMP_CVEMC      YNTGRSVYVKFQ-DSKPPLPPDEWV-----
VEMP_BCHK5      YNTGRAAYVKFQ-ESHPPYPPEDWV-----
VEMP_BCHK4      YNTGRNAYFKFQ-ENRPPFPPEDWV-----
VEMP_BC133      YNTGRNAYFKFQ-ENRPPFPPEDWV-----
                :.